Player Zuan attempting 'use_item' action with item 'draught_of_souls' which is not currently equipped.
Player Zuan attempting 'use_item' action with item 'kiljaedens_burning_wish' which is not currently equipped.
Player Islandar attempting 'use_item' action with item 'draught_of_souls' which is not currently equipped.
close

SimulationCraft 715-01

for World of Warcraft 7.1.5 Live (wow build level 23360, git build 4e1343e)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00
2016-11-30 Reverse the incorrect AC mana cost adjustment from 60& back to 120%
Arcane Charge (effect#2) base_value 120.00 60.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Bonerot

Bonerot : 452661 dps

  • Race: Human
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
452661.5 452661.5 252.4 / 0.056% 50400.8 / 11.1% 57044.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.9 Runic Power 15.07% 48.4 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Bonerot/advanced
Talents
  • 15: Icy Talons (Frost Death Knight)
  • 30: Frozen Pulse (Frost Death Knight)
  • 45: Avalanche (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: Permafrost (Frost Death Knight)
  • 90: Runic Attenuation (Frost Death Knight)
  • 100: Obliteration (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • inscription: 763
  • enchanting: 794

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Bonerot 452661
auto_attack_mh 19932 4.4% 219.8 1.37sec 27257 19953 Direct 219.8 26158 52317 27257 23.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 219.80 219.80 0.00 0.00 1.3660 0.0000 5991000.55 8807338.30 31.98 19953.17 19953.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.05 57.80% 26158.24 22947 29534 26161.19 25217 26968 3323283 4885541 31.98
crit 50.99 23.20% 52317.17 45894 59067 52323.59 49645 55123 2667717 3921797 31.98
miss 41.76 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9982 2.2% 219.8 1.37sec 13650 9992 Direct 219.8 13102 26204 13650 23.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 219.80 219.80 0.00 0.00 1.3660 0.0000 3000236.03 4410631.16 31.98 9992.36 9992.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.13 57.84% 13101.83 11474 14767 13103.23 12690 13535 1665693 2448726 31.98
crit 50.93 23.17% 26204.30 22947 29534 26207.90 24800 27579 1334543 1961905 31.98
miss 41.74 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Avalanche 11544 2.5% 66.7 4.34sec 51966 0 Direct 66.7 42157 84307 51966 23.3% 0.0%  

Stats details: avalanche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.65 66.65 0.00 0.00 0.0000 0.0000 3463652.26 3463652.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.14 76.73% 42157.26 33994 43648 42162.91 39323 43648 2155909 2155909 0.00
crit 15.51 23.27% 84306.57 67988 87295 84309.35 76734 87295 1307743 1307743 0.00
 
 

Action details: avalanche

Static Values
  • id:207150
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=While Pillar of Frost is active, your melee critical strikes cause jagged icicles to fall on your nearby enemies, dealing {$207150s1=0} Frost damage.}
 
Crystalline Swords 21568 4.8% 70.5 8.46sec 92010 0 Direct 66.8 78863 157721 97113 23.1% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.53 66.82 0.00 0.00 0.0000 0.0000 6489069.39 6489069.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.36 76.86% 78862.80 60007 104754 78865.73 69178 86868 4050059 4050059 0.00
crit 15.46 23.14% 157720.70 120014 209509 157740.40 124514 200399 2439011 2439011 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Frost Fever 14612 (22596) 3.2% (5.0%) 35.2 8.70sec 193199 0 Periodic 99.9 35684 71412 43999 23.3% 0.0% 99.3%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.18 0.00 99.90 99.90 0.0000 2.9917 4395560.52 4395560.52 0.00 22741.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.7 76.73% 35683.94 11 48012 35687.25 33086 38047 2735212 2735212 0.00
crit 23.3 23.27% 71412.35 84 96025 71426.73 58463 84267 1660349 1660349 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Hypothermia 7985 1.8% 10.0 27.39sec 240688 0 Direct 10.0 195286 390554 240677 23.2% 0.0%  

Stats details: hypothermia

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.98 9.98 0.00 0.00 0.0000 0.0000 2401128.46 2401128.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.66 76.75% 195285.89 150017 261886 195245.19 0 261886 1495348 1495348 0.00
crit 2.32 23.25% 390554.33 300034 523772 352095.13 0 523772 905781 905781 0.00
 
 

Action details: hypothermia

Static Values
  • id:228322
  • school:frost
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228322
  • name:Hypothermia
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage.
 
Frost Strike 0 (105365) 0.0% (23.3%) 95.4 3.15sec 331889 291828

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.37 0.00 0.00 0.00 1.1373 0.0000 0.00 0.00 0.00 291827.99 291827.99
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.icy_talons.enabled&buff.icy_talons.remains<1.5&cooldown.breath_of_sindragosa.remains>6
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 63852 14.1% 95.4 3.15sec 201126 0 Direct 95.4 163197 326781 201124 23.2% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.37 95.37 0.00 0.00 0.0000 0.0000 19180985.44 19180985.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.26 76.81% 163196.89 129708 210233 163224.53 153625 174722 11955425 11955425 0.00
crit 22.11 23.19% 326781.00 259415 420467 326811.00 278618 387732 7225560 7225560 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
    Frost Strike Off-Hand 41513 9.2% 95.4 3.15sec 130763 0 Direct 95.4 106165 212185 130763 23.2% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.37 95.37 0.00 0.00 0.0000 0.0000 12470677.98 12470677.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.24 76.80% 106164.97 84313 136655 106183.29 99842 113237 7775812 7775812 0.00
crit 22.13 23.20% 212185.14 168626 273311 212261.14 182526 246274 4694866 4694866 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
Frozen Pulse 48795 10.8% 276.2 1.80sec 53145 0 Direct 276.2 43131 86243 53144 23.2% 0.0%  

Stats details: frozen_pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.17 276.17 0.00 0.00 0.0000 0.0000 14677149.26 14677149.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 212.03 76.77% 43130.76 33005 57617 43145.20 40102 46119 9144960 9144960 0.00
crit 64.15 23.23% 86242.77 66011 115234 86279.21 77916 97059 5532189 5532189 0.00
 
 

Action details: frozen_pulse

Static Values
  • id:195750
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195750
  • name:Frozen Pulse
  • school:frost
  • tooltip:
  • description:{$@spelldesc194909=While you have fewer than $m2 full $LRune:Runes;, your auto attacks radiate intense cold, inflicting {$195750s1=1} Frost damage on all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.660000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Howling Blast 39362 8.7% 35.2 8.70sec 336040 297337 Direct 35.2 272606 546122 336045 23.2% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.18 35.18 0.00 0.00 1.1302 0.0000 11821813.35 11821813.35 0.00 297336.79 297336.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.02 76.81% 272606.22 53631 374497 272241.75 220378 315162 7366268 7366268 0.00
crit 8.16 23.19% 546121.84 107262 748993 545488.06 0 748993 4455545 4455545 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Kil'jaeden's Burning Wish 9508 2.1% 4.5 75.30sec 633905 0 Direct 4.5 0 634060 634060 100.0% 0.0%  

Stats details: kiljaedens_burning_wish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.49 4.49 0.00 0.00 0.0000 0.0000 2847848.24 2847848.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.49 100.00% 634060.00 634060 634060 634060.00 634060 634060 2847848 2847848 0.00
 
 

Action details: kiljaedens_burning_wish

Static Values
  • id:235999
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:29.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:235999
  • name:Kil'jaeden's Burning Wish
  • school:fire
  • tooltip:
  • description:{$@spelldesc235991=Launch a vortex of destruction that seeks your current enemy. When it reaches the target, it explodes, dealing a critical strike to all enemies within $235999A1 yds for ${{$235999s1=112984 to 124877}*{$s2=200}/100} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:317030.00
  • base_dd_max:317030.00
 
Mark of the Hidden Satyr 7934 1.8% 19.0 15.92sec 125223 0 Direct 19.0 101695 203208 125221 23.2% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.04 19.04 0.00 0.00 0.0000 0.0000 2384211.36 2384211.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.63 76.82% 101694.75 85752 118338 101695.86 90576 115521 1487439 1487439 0.00
crit 4.41 23.18% 203208.14 171504 236677 200936.38 0 236677 896772 896772 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Obliterate 0 (99208) 0.0% (21.9%) 83.5 3.62sec 356913 315884

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.46 0.00 0.00 0.00 1.1299 0.0000 0.00 0.00 0.00 315883.74 315883.74
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.rime.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 60141 13.3% 83.5 3.62sec 216360 0 Direct 83.5 112413 293282 216361 57.5% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.46 83.46 0.00 0.00 0.0000 0.0000 18056933.34 26545402.41 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.49 42.53% 112412.77 98563 126287 112416.54 105682 118337 3989991 5865664 31.98
crit 47.96 57.47% 293281.82 256263 328346 293340.32 280922 305782 14066942 20679738 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.56
 
    Obliterate Off-Hand 39068 8.6% 83.5 3.62sec 140553 0 Direct 83.5 73077 190627 140551 57.4% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.46 83.46 0.00 0.00 0.0000 0.0000 11730271.42 17244610.11 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.55 42.60% 73077.06 64068 82089 73081.44 68641 76905 2597999 3819304 31.98
crit 47.91 57.40% 190626.96 166577 213430 190661.84 180662 198764 9132273 13425306 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.56
 
Pepper Breath 4274 0.9% 15.2 19.67sec 84306 0 Periodic 75.7 16963 0 16963 0.0% 0.0% 6.3%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.24 0.00 75.79 75.72 0.0000 0.2496 1284435.37 1284435.37 0.00 67902.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.7 100.00% 16962.86 68 16990 16964.15 16469 16990 1284435 1284435 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Potion of the Old War 13727 3.0% 26.4 3.36sec 153873 0 Direct 26.4 124816 249633 153875 23.3% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.39 26.39 0.00 0.00 0.0000 0.0000 4060747.50 5969683.47 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.25 76.72% 124816.45 124816 124816 124816.45 124816 124816 2527124 3715112 31.98
crit 6.14 23.28% 249632.89 249633 249633 249108.61 0 249633 1533623 2254571 31.91
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Razorice 11452 2.5% 356.8 0.84sec 9641 0 Direct 356.8 7827 15656 9641 23.2% 0.0%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 356.84 356.84 0.00 0.00 0.0000 0.0000 3440382.21 3440382.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 274.16 76.83% 7827.04 6201 10096 7828.84 7496 8164 2145874 2145874 0.00
crit 82.68 23.17% 15656.41 12402 20191 15659.67 14481 17136 1294508 1294508 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Remorseless Winter 0 (9193) 0.0% (2.0%) 9.5 28.71sec 290434 248573

Stats details: remorseless_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.53 0.00 0.00 0.00 1.1684 0.0000 0.00 0.00 0.00 248573.09 248573.09
 
 

Action details: remorseless_winter

Static Values
  • id:196770
  • school:frost
  • resource:rune
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.gathering_storm.enabled
Spelldata
  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
 
    Remorseless Winter (_damage) 8213 1.8% 75.0 3.38sec 32976 0 Direct 75.0 26765 53522 32976 23.2% 0.0%  

Stats details: remorseless_winter_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.01 75.01 0.00 0.00 0.0000 0.0000 2473627.22 2473627.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.60 76.79% 26765.07 20702 36140 26775.12 22420 32295 1541725 1541725 0.00
crit 17.41 23.21% 53522.19 41405 72280 53551.90 43475 70185 931902 931902 0.00
 
 

Action details: remorseless_winter_damage

Static Values
  • id:196771
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.}
 
    Frozen Soul 980 0.2% 9.2 28.65sec 31975 0 Direct 9.2 25964 51869 31976 23.2% 0.0%  

Stats details: frozen_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.23 9.23 0.00 0.00 0.0000 0.0000 294979.85 294979.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.08 76.80% 25964.38 20004 34920 25980.96 20004 34920 183958 183958 0.00
crit 2.14 23.20% 51868.55 40008 69840 46960.54 0 69840 111022 111022 0.00
 
 

Action details: frozen_soul

Static Values
  • id:204959
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204959
  • name:Frozen Soul
  • school:frost
  • tooltip:
  • description:{$@spelldesc189184=When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Flesh 8256 1.8% 37.2 8.11sec 66677 0 Periodic 116.0 17383 34750 21410 23.2% 0.0% 77.1%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.25 0.00 116.00 116.00 0.0000 2.0000 2483543.80 2483543.80 0.00 10705.07 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.1 76.81% 17382.69 13797 48650 17358.16 14234 21629 1548790 1548790 0.00
crit 26.9 23.19% 34749.69 27594 97131 34709.09 27939 48657 934754 934754 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Sindragosa's Fury 9965 2.2% 1.4 302.64sec 2142240 2135422 Direct 1.4 1742741 3485962 2142018 22.9% 0.0%  

Stats details: sindragosas_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.43 1.43 0.00 0.00 1.0032 0.0000 3057924.76 3057924.76 0.00 2135422.32 2135422.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.10 77.08% 1742740.61 1518172 1745905 1473273.83 0 1745905 1917552 1917552 0.00
crit 0.33 22.92% 3485962.35 3036343 3491811 1058488.77 0 3491811 1140372 1140372 0.00
 
 

Action details: sindragosas_fury

Static Values
  • id:190778
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
Spelldata
  • id:190778
  • name:Sindragosa's Fury
  • school:frost
  • tooltip:
  • description:Summons Sindragosa, who breathes frost on all enemies within {$s1=40} yd in front of you, dealing {$190780s1=0} Frost damage and slowing movement speed by {$190780s2=50}% for {$190780d=10 seconds}.
 
Simple Action Stats Execute Interval
Bonerot
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bonerot
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.0 190.29sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<20
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bonerot
  • harmful:false
  • if_expr:
 
Obliteration 3.6 92.94sec

Stats details: obliteration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: obliteration

Static Values
  • id:207256
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
Spelldata
  • id:207256
  • name:Obliteration
  • school:physical
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
 
Pillar of Frost 5.5 60.31sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rend Flesh (rending_flesh_trigger) 37.3 8.11sec

Stats details: rending_flesh_trigger

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rending_flesh_trigger

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51100.00
  • base_dd_max:51100.00
 
Unholy Strength 22.9 13.24sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 22.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bonerot
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 16.66% 0.0(0.0) 1.0

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Frozen Pulse 67.3 0.0 4.4sec 4.4sec 77.66% 77.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_frozen_pulse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frozen_pulse_1:77.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194909
  • name:Frozen Pulse
  • tooltip:
  • description:While you have fewer than $m2 full $LRune:Runes;, your auto attacks radiate intense cold, inflicting {$195750s1=1} Frost damage on all nearby enemies.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Frozen Soul 9.5 0.0 28.7sec 28.7sec 24.86% 24.86% 0.0(0.0) 9.2

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_frozen_soul
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • frozen_soul_1:24.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:189184
  • name:Frozen Soul
  • tooltip:
  • description:When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icy Talons 3.7 91.7 80.5sec 3.1sec 98.52% 95.27% 84.7(84.7) 2.7

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • icy_talons_1:4.36%
  • icy_talons_2:3.93%
  • icy_talons_3:90.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$s1=10}%.
  • description:{$@spelldesc194878=Frost Strike also increases your melee attack speed by {$194879s1=10}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 37.4 5.3 8.0sec 7.0sec 25.74% 44.60% 5.3(5.3) 0.0

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:25.74%

Trigger Attempt Success

  • trigger_pct:42.23%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Obliteration 3.6 0.0 93.0sec 93.0sec 9.40% 12.11% 0.0(0.0) 3.5

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207256
  • name:Obliteration
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:100.00%
Pillar of Frost 5.5 0.0 60.3sec 60.3sec 35.29% 36.13% 0.0(0.0) 5.1

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:35.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 60.3sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Remorseless Winter 9.5 0.0 28.7sec 28.7sec 24.95% 24.95% 75.0(75.0) 9.3

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • remorseless_winter_1:24.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 34.0 3.5 8.8sec 7.9sec 21.69% 96.04% 3.5(3.5) 0.0

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:21.69%

Trigger Attempt Success

  • trigger_pct:44.97%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 8.8 14.1 35.5sec 13.2sec 72.10% 69.85% 14.1(14.1) 8.1

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:72.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Killing Machine: Obliterate 37.2 8.0sec
Rune ready 158.4 2.3sec

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=80809)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.2431.397 / 0.9143.65513.199
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
3.0145.11111.284 / 9.58923.28745.482

Resources

Resource Usage Type Count Total Average RPE APR
Bonerot
frost_strike Runic Power 95.4 2384.2 25.0 25.0 13275.6
howling_blast Rune 35.2 1.3 0.0 0.0 8835677.5
obliterate Rune 83.5 152.8 1.8 1.8 194961.8
remorseless_winter Rune 9.5 9.5 1.0 1.0 290447.0
Resource Gains Type Count Total Average Overflow
remorseless_winter Runic Power 9.53 95.32 (3.95%) 10.00 0.00 0.00%
obliterate Runic Power 83.46 1668.55 (69.19%) 19.99 0.60 0.04%
Frost Fever Runic Power 17.64 88.01 (3.65%) 4.99 0.20 0.23%
Rune Regeneration Rune 111.64 111.64 (70.46%) 1.00 0.00 0.00%
Runic Empowerment Rune 35.69 35.69 (22.52%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 11.12 11.12 (7.02%) 1.00 0.00 0.00%
Runic Attenuation Runic Power 439.60 438.77 (18.20%) 1.00 0.82 0.19%
Over-Powered Runic Power 8.33 107.35 (4.45%) 12.89 0.93 0.86%
Howling Blast Runic Power 1.34 13.38 (0.55%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 8.02 7.93
Rune 0.53 0.54
Combat End Resource Mean Min Max
Runic Power 27.55 0.00 97.00
Rune 0.78 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.2%

Statistics & Data Analysis

Fight Length
Sample Data Bonerot Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Bonerot Damage Per Second
Count 9999
Mean 452661.46
Minimum 408746.21
Maximum 502367.89
Spread ( max - min ) 93621.68
Range [ ( max - min ) / 2 * 100% ] 10.34%
Standard Deviation 12877.5991
5th Percentile 431925.41
95th Percentile 474228.82
( 95th Percentile - 5th Percentile ) 42303.41
Mean Distribution
Standard Deviation 128.7824
95.00% Confidence Intervall ( 452409.05 - 452913.87 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3109
0.1 Scale Factor Error with Delta=300 1415643
0.05 Scale Factor Error with Delta=300 5662569
0.01 Scale Factor Error with Delta=300 141564211
Priority Target DPS
Sample Data Bonerot Priority Target Damage Per Second
Count 9999
Mean 452661.46
Minimum 408746.21
Maximum 502367.89
Spread ( max - min ) 93621.68
Range [ ( max - min ) / 2 * 100% ] 10.34%
Standard Deviation 12877.5991
5th Percentile 431925.41
95th Percentile 474228.82
( 95th Percentile - 5th Percentile ) 42303.41
Mean Distribution
Standard Deviation 128.7824
95.00% Confidence Intervall ( 452409.05 - 452913.87 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3109
0.1 Scale Factor Error with Delta=300 1415643
0.05 Scale Factor Error with Delta=300 5662569
0.01 Scale Factor Error with Delta=300 141564211
DPS(e)
Sample Data Bonerot Damage Per Second (Effective)
Count 9999
Mean 452661.46
Minimum 408746.21
Maximum 502367.89
Spread ( max - min ) 93621.68
Range [ ( max - min ) / 2 * 100% ] 10.34%
Damage
Sample Data Bonerot Damage
Count 9999
Mean 136006178.33
Minimum 101923707.67
Maximum 176494747.01
Spread ( max - min ) 74571039.34
Range [ ( max - min ) / 2 * 100% ] 27.41%
DTPS
Sample Data Bonerot Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Bonerot Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Bonerot Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Bonerot Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Bonerot Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Bonerot Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BonerotTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Bonerot Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 5.50 pillar_of_frost
0.00 mind_freeze
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=buff.pillar_of_frost.up
0.00 berserking,if=buff.pillar_of_frost.up
7 4.49 use_item,slot=trinket1
8 1.00 potion,name=old_war,if=buff.pillar_of_frost.up
9 1.43 sindragosas_fury,if=buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
A 3.56 obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
B 0.00 call_action_list,name=generic,if=!talent.breath_of_sindragosa.enabled&!(talent.gathering_storm.enabled&buff.remorseless_winter.remains)
C 0.00 call_action_list,name=bos,if=talent.breath_of_sindragosa.enabled&!dot.breath_of_sindragosa.ticking
D 0.00 call_action_list,name=bos_ticking,if=talent.breath_of_sindragosa.enabled&dot.breath_of_sindragosa.ticking
E 0.00 call_action_list,name=gs_ticking,if=talent.gathering_storm.enabled&buff.remorseless_winter.remains&!talent.breath_of_sindragosa.enabled
actions.generic
# count action,conditions
F 23.46 frost_strike,if=!talent.shattering_strikes.enabled&(buff.icy_talons.remains<1.5&talent.icy_talons.enabled)
0.00 frost_strike,if=talent.shattering_strikes.enabled&debuff.razorice.stack=5
G 1.51 howling_blast,target_if=!dot.frost_fever.ticking
0.00 obliterate,if=equipped.132366&talent.runic_attenuation.enabled&set_bonus.tier19_2pc=1
0.00 remorseless_winter,if=(buff.rime.react&equipped.132459&!(buff.obliteration.up&spell_targets.howling_blast<2))|talent.gathering_storm.enabled
H 33.67 howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
I 0.90 frost_strike,if=runic_power.deficit<=10
J 10.70 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2&!(talent.frostscythe.enabled&buff.killing_machine.react&spell_targets.frostscythe>=2)
0.00 frostscythe,if=(buff.killing_machine.react&spell_targets.frostscythe>=2)
0.00 glacial_advance,if=spell_targets.glacial_advance>=2
0.00 frostscythe,if=spell_targets.frostscythe>=3
K 32.65 obliterate,if=buff.killing_machine.react
L 50.81 obliterate
0.00 glacial_advance
0.00 horn_of_winter,if=!dot.hungering_rune_weapon.ticking
M 60.31 frost_strike
N 9.53 remorseless_winter,if=talent.frozen_pulse.enabled
O 1.99 empower_rune_weapon
0.00 hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking

Sample Sequence

024567GKFLH9MLLHMMAOKJKJLJKJKHLLFLMLMMMLMNMLHMKMMLMLHFLHMLMNMLFH68MLHMKHMN7LFMLFLHFKHFLHMMLMALJKJKLJHKHFLHMKH6LFHMMKMNMKFHKMLHFKHFK7HMLMMLMNMKHMLMLHMLHFLM6LHMNKFMAKLJKJKJHKHFLHMLHMLMLMMMNOKLFLM7MKHLFMKFLM6MLHLFMNKFFLLMMKMLHMMNMKHKFMALJKLJKJHKLFHLHFL67MK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Bonerot 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre precombat 2 augmentation Bonerot 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre precombat 4 potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 default 6 pillar_of_frost Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, potion_of_the_old_war
0:00.000 default 7 use_item_kiljaedens_burning_wish Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:00.000 generic G howling_blast Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:00.913 generic K obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:01.826 generic F frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:02.740 generic L obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 3.0/6: 50% rune bloodlust, icy_talons, pillar_of_frost, potion_of_the_old_war
0:03.653 generic H howling_blast Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune bloodlust, icy_talons, pillar_of_frost, rime, frozen_pulse, potion_of_the_old_war
0:04.566 default 9 sindragosas_fury Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune bloodlust, icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:05.479 generic M frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune bloodlust, icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:06.391 generic L obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(2), pillar_of_frost, unholy_strength, potion_of_the_old_war
0:07.304 generic L obliterate Fluffy_Pillow 32.0/100: 32% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(2), pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:08.217 generic H howling_blast Fluffy_Pillow 54.0/100: 54% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(2), killing_machine, pillar_of_frost, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
0:09.130 generic M frost_strike Fluffy_Pillow 56.0/100: 56% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(2), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.042 generic M frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.955 default A obliteration Fluffy_Pillow 8.0/100: 8% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.955 generic O empower_rune_weapon Fluffy_Pillow 8.0/100: 8% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.955 generic K obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 6.0/6: 100% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:11.867 generic J frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:12.779 generic K obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 6.0/6: 100% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:13.691 generic J frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:14.604 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:15.517 generic J frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:16.433 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:17.346 generic J frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:18.259 generic K obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:19.173 generic H howling_blast Fluffy_Pillow 24.0/100: 24% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:20.087 generic L obliterate Fluffy_Pillow 26.0/100: 26% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), unholy_strength, potion_of_the_old_war
0:20.999 generic L obliterate Fluffy_Pillow 48.0/100: 48% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, potion_of_the_old_war
0:21.912 generic F frost_strike Fluffy_Pillow 83.0/100: 83% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
0:22.826 generic L obliterate Fluffy_Pillow 58.0/100: 58% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, potion_of_the_old_war
0:23.741 generic M frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:24.654 generic L obliterate Fluffy_Pillow 62.0/100: 62% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength
0:25.568 generic M frost_strike Fluffy_Pillow 84.0/100: 84% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:26.481 generic M frost_strike Fluffy_Pillow 61.0/100: 61% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:27.394 generic M frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:28.308 generic L obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength
0:29.221 generic M frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:30.135 generic N remorseless_winter Fluffy_Pillow 17.0/100: 17% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:31.050 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, remorseless_winter
0:31.964 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
0:32.877 generic H howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:33.792 generic M frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:34.705 generic K obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
0:35.619 generic M frost_strike Fluffy_Pillow 53.0/100: 53% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:36.532 generic M frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:37.445 generic L obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
0:38.359 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul
0:39.274 Waiting     1.700 sec 6.0/100: 6% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:40.974 generic L obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune icy_talons(3)
0:42.161 generic H howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
0:43.346 generic F frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
0:44.532 generic L obliterate Fluffy_Pillow 9.0/100: 9% runic_power | 2.0/6: 33% rune icy_talons(3)
0:45.719 generic H howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
0:46.905 generic M frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
0:48.092 Waiting     0.700 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
0:48.792 generic L obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
0:49.978 generic M frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
0:51.164 generic N remorseless_winter Fluffy_Pillow 17.0/100: 17% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
0:52.351 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:53.536 Waiting     3.200 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:56.736 generic L obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
0:57.923 generic F frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:59.109 generic H howling_blast Fluffy_Pillow 22.0/100: 22% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
1:00.296 default 6 pillar_of_frost Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
1:00.296 default 8 potion Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
1:00.296 Waiting     1.100 sec 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
1:01.396 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
1:02.583 generic L obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength, potion_of_the_old_war
1:03.770 generic H howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
1:04.955 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
1:06.141 Waiting     0.800 sec 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, potion_of_the_old_war
1:06.941 generic K obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, potion_of_the_old_war
1:08.129 generic H howling_blast Fluffy_Pillow 24.0/100: 24% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
1:09.315 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
1:10.502 Waiting     0.500 sec 3.0/100: 3% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
1:11.002 generic N remorseless_winter Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
1:12.352 Waiting     2.400 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:14.752 default 7 use_item_kiljaedens_burning_wish Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:15.000 generic L obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
1:16.188 generic F frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:17.375 Waiting     1.500 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:18.875 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:20.064 Waiting     0.300 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, potion_of_the_old_war
1:20.364 generic L obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons(2), unholy_strength, potion_of_the_old_war
1:21.549 Waiting     1.900 sec 22.0/100: 22% runic_power | 0.0/6: 0% rune icy_talons(2), unholy_strength, frozen_pulse, potion_of_the_old_war
1:23.449 generic F frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(2), unholy_strength, frozen_pulse, potion_of_the_old_war
1:24.634 Waiting     1.200 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
1:25.834 generic L obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
1:27.019 generic H howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
1:28.205 generic F frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
1:29.390 Waiting     1.200 sec 4.0/100: 4% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse
1:30.590 generic K obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine
1:31.777 generic H howling_blast Fluffy_Pillow 39.0/100: 39% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
1:32.962 generic F frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse
1:34.148 generic L obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine
1:35.336 generic H howling_blast Fluffy_Pillow 53.0/100: 53% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
1:36.524 generic M frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
1:37.710 generic M frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
1:38.897 generic L obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 2.0/6: 33% rune icy_talons(3)
1:40.083 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse
1:41.268 default A obliteration Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
1:41.268 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, frozen_pulse
1:42.456 generic J frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, rime, frozen_pulse
1:43.643 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength
1:44.830 generic J frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, rime, unholy_strength
1:46.016 generic K obliterate Fluffy_Pillow 4.0/100: 4% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength
1:47.201 generic L obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, rime, unholy_strength
1:48.388 generic J frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, rime, unholy_strength, frozen_pulse
1:49.575 generic H howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, rime, unholy_strength
1:50.760 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
1:51.947 generic H howling_blast Fluffy_Pillow 57.0/100: 57% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse
1:53.135 generic F frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
1:54.323 generic L obliterate Fluffy_Pillow 34.0/100: 34% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength
1:55.508 generic H howling_blast Fluffy_Pillow 56.0/100: 56% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
1:56.695 generic M frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
1:57.881 generic K obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, unholy_strength
1:59.066 generic H howling_blast Fluffy_Pillow 57.0/100: 57% runic_power | 1.0/6: 17% rune icy_talons(3), rime, frozen_pulse
2:00.254 default 6 pillar_of_frost Fluffy_Pillow 59.0/100: 59% runic_power | 2.0/6: 33% rune icy_talons(3)
2:00.296 generic L obliterate Fluffy_Pillow 59.0/100: 59% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
2:01.484 generic F frost_strike Fluffy_Pillow 81.0/100: 81% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse
2:02.668 generic H howling_blast Fluffy_Pillow 56.0/100: 56% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse
2:03.854 generic M frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
2:05.041 generic M frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse
2:06.228 generic K obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost
2:07.415 generic M frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse
2:08.603 generic N remorseless_winter Fluffy_Pillow 16.0/100: 16% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
2:09.790 generic M frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
2:10.978 Waiting     2.200 sec 8.0/100: 8% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
2:13.178 generic K obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_soul, remorseless_winter
2:14.365 generic F frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse, frozen_soul, remorseless_winter
2:15.553 generic H howling_blast Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, rime, frozen_soul, remorseless_winter
2:16.741 generic K obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_soul
2:17.925 generic M frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:19.110 Waiting     1.900 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:21.010 generic L obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:22.195 generic H howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:23.382 generic F frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:24.568 Waiting     1.200 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:25.768 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
2:26.956 generic H howling_blast Fluffy_Pillow 37.0/100: 37% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
2:28.143 generic F frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:29.330 generic K obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
2:30.519 default 7 use_item_kiljaedens_burning_wish Fluffy_Pillow 49.0/100: 49% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:30.519 generic H howling_blast Fluffy_Pillow 49.0/100: 49% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:31.706 generic M frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
2:32.892 generic L obliterate Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:34.079 generic M frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
2:35.264 generic M frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
2:36.451 generic L obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:37.636 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
2:38.823 generic N remorseless_winter Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
2:40.009 Waiting     0.900 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:40.909 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:42.097 generic K obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
2:43.283 generic H howling_blast Fluffy_Pillow 22.0/100: 22% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:44.469 Waiting     0.600 sec 24.0/100: 24% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:45.069 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:46.255 Waiting     0.800 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:47.055 generic L obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, frozen_soul
2:48.240 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:49.426 generic L obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:50.613 Waiting     0.100 sec 22.0/100: 22% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:50.713 generic H howling_blast Fluffy_Pillow 24.0/100: 24% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:51.899 Waiting     0.200 sec 24.0/100: 24% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:52.099 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:53.286 Waiting     1.600 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
2:54.886 generic L obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:56.072 generic H howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:57.257 generic F frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:58.444 generic L obliterate Fluffy_Pillow 9.0/100: 9% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:59.631 generic M frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:00.818 default 6 pillar_of_frost Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:00.818 generic L obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
3:02.006 generic H howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse
3:03.191 generic M frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
3:04.376 generic N remorseless_winter Fluffy_Pillow 7.0/100: 7% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
3:05.565 Waiting     2.800 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:08.365 generic K obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
3:09.553 generic F frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:10.739 generic M frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 1.0/6: 17% rune icy_talons, killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:11.926 default A obliteration Fluffy_Pillow 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:11.926 generic K obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, obliteration, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:13.115 generic L obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(2), obliteration, pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul
3:14.302 generic J frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 0.0/6: 0% rune icy_talons(2), obliteration, pillar_of_frost, rime, frozen_pulse
3:15.488 generic K obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, frozen_pulse
3:16.674 generic J frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, pillar_of_frost, rime, frozen_pulse
3:17.861 generic K obliterate Fluffy_Pillow 33.0/100: 33% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime
3:19.048 generic J frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, pillar_of_frost, rime
3:20.235 generic H howling_blast Fluffy_Pillow 32.0/100: 32% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, rime, unholy_strength
3:21.424 generic K obliterate Fluffy_Pillow 34.0/100: 34% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, unholy_strength
3:22.610 generic H howling_blast Fluffy_Pillow 56.0/100: 56% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:23.796 generic F frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:24.985 generic L obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:26.169 generic H howling_blast Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:27.356 generic M frost_strike Fluffy_Pillow 62.0/100: 62% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:28.540 generic L obliterate Fluffy_Pillow 39.0/100: 39% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:29.728 generic H howling_blast Fluffy_Pillow 61.0/100: 61% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:30.917 generic M frost_strike Fluffy_Pillow 63.0/100: 63% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:32.103 generic L obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
3:33.291 generic M frost_strike Fluffy_Pillow 73.0/100: 73% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:34.477 generic L obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune icy_talons(3)
3:35.663 generic M frost_strike Fluffy_Pillow 72.0/100: 72% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse
3:36.849 generic M frost_strike Fluffy_Pillow 49.0/100: 49% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse
3:38.035 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse
3:39.224 generic N remorseless_winter Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse
3:40.410 generic O empower_rune_weapon Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
3:40.410 generic K obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 6.0/6: 100% rune icy_talons(3), killing_machine, frozen_soul, remorseless_winter
3:41.595 generic L obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
3:42.783 generic F frost_strike Fluffy_Pillow 62.0/100: 62% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
3:43.970 generic L obliterate Fluffy_Pillow 39.0/100: 39% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
3:45.157 generic M frost_strike Fluffy_Pillow 61.0/100: 61% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:46.344 default 7 use_item_kiljaedens_burning_wish Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:46.344 generic M frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:47.531 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul
3:48.718 generic H howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune icy_talons(3), rime, unholy_strength
3:49.905 generic L obliterate Fluffy_Pillow 37.0/100: 37% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength
3:51.091 generic F frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:52.278 generic M frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:53.465 Waiting     2.800 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
3:56.265 generic K obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine
3:57.451 generic F frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 2.0/6: 33% rune icy_talons(3)
3:58.639 generic L obliterate Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune icy_talons(3)
3:59.826 generic M frost_strike Fluffy_Pillow 49.0/100: 49% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse
4:01.013 default 6 pillar_of_frost Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
4:01.013 generic M frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
4:02.199 generic L obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
4:03.386 generic H howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse
4:04.573 generic L obliterate Fluffy_Pillow 32.0/100: 32% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
4:05.760 generic F frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
4:06.945 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
4:08.132 generic N remorseless_winter Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
4:09.320 Waiting     2.700 sec 18.0/100: 18% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
4:12.020 generic K obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
4:13.207 generic F frost_strike Fluffy_Pillow 44.0/100: 44% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:14.393 Waiting     3.500 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:17.893 generic F frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse
4:19.080 Waiting     0.800 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), pillar_of_frost, unholy_strength, frozen_pulse
4:19.880 generic L obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 3.0/6: 50% rune icy_talons(2), pillar_of_frost, unholy_strength
4:21.067 generic L obliterate Fluffy_Pillow 37.0/100: 37% runic_power | 2.0/6: 33% rune icy_talons(2), unholy_strength
4:22.253 generic M frost_strike Fluffy_Pillow 57.0/100: 57% runic_power | 0.0/6: 0% rune icy_talons(2), unholy_strength, frozen_pulse
4:23.440 generic M frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
4:24.628 generic K obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
4:25.816 generic M frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
4:27.003 Waiting     0.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
4:27.703 generic L obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
4:28.890 generic H howling_blast Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
4:30.075 generic M frost_strike Fluffy_Pillow 57.0/100: 57% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
4:31.259 generic M frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
4:32.447 generic N remorseless_winter Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
4:33.632 Waiting     1.500 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:35.132 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
4:36.318 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, frozen_soul, remorseless_winter
4:37.504 generic H howling_blast Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, rime, frozen_soul, remorseless_winter
4:38.692 generic K obliterate Fluffy_Pillow 29.0/100: 29% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, frozen_soul, remorseless_winter
4:39.879 generic F frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse, frozen_soul, remorseless_winter
4:41.067 generic M frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse, frozen_soul
4:42.255 default A obliteration Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
4:42.255 generic L obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, frozen_pulse
4:43.443 generic J frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), obliteration, frozen_pulse
4:44.629 generic K obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration
4:45.814 generic L obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, rime
4:47.001 generic J frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, rime, unholy_strength, frozen_pulse
4:48.188 generic K obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength
4:49.375 generic J frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, rime, unholy_strength, frozen_pulse
4:50.561 generic H howling_blast Fluffy_Pillow 22.0/100: 22% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, rime, unholy_strength
4:51.747 generic K obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 4.0/6: 67% rune icy_talons(3), killing_machine, unholy_strength
4:52.934 generic L obliterate Fluffy_Pillow 44.0/100: 44% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength
4:54.121 generic F frost_strike Fluffy_Pillow 66.0/100: 66% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse
4:55.307 generic H howling_blast Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune icy_talons(3), rime, unholy_strength
4:56.493 generic L obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
4:57.679 generic H howling_blast Fluffy_Pillow 72.0/100: 72% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
4:58.865 generic F frost_strike Fluffy_Pillow 72.0/100: 72% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
5:00.050 generic L obliterate Fluffy_Pillow 49.0/100: 49% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
5:01.237 default 6 pillar_of_frost Fluffy_Pillow 71.0/100: 71% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
5:01.237 default 7 use_item_kiljaedens_burning_wish Fluffy_Pillow 71.0/100: 71% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
5:01.344 generic M frost_strike Fluffy_Pillow 71.0/100: 71% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
5:02.530 generic K obliterate Fluffy_Pillow 48.0/100: 48% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 31760 30054 18392 (11527)
Agility 7857 7532 0
Stamina 42280 42280 25002
Intellect 4327 4002 0
Spirit 0 0 0
Health 2536800 2536800 0
Runic Power 100 100 0
Rune 6 6 0
Crit 23.20% 23.20% 7282
Haste 26.87% 26.87% 10075
Swing Speed 42.09% 42.09% 10075
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 31760 30054 0
Mastery 25.51% 25.51% 3602
Armor 4717 4717 4288
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 878.00
Local Head Insurmountable Skullfortress
ilevel: 880, stats: { 593 Armor, +1801 StrInt, +2702 Sta, +1030 Crit, +504 Haste }
Local Neck An'she's Pendant
ilevel: 845, stats: { +1097 Sta, +1381 Haste, +720 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Crusader's Inferno Pauldrons
ilevel: 870, stats: { 535 Armor, +1231 StrInt, +1846 Sta, +554 Haste, +554 Mastery }
Local Chest Dreadwyrm Breastplate
ilevel: 875, stats: { 721 Armor, +2578 Sta, +1719 Str, +1075 Haste, +430 Crit }
Local Waist Waistplate of Nameless Horror
ilevel: 870, stats: { 401 Armor, +1846 Sta, +1231 StrInt, +673 Haste, +435 Crit }
Local Legs Tassets of Perpetual Despair
ilevel: 860, stats: { 611 Armor, +1495 StrInt, +2242 Sta, +1016 Haste, +406 Crit }
Local Feet Sabatons of the Illidari Crusade
ilevel: 870, stats: { 490 Armor, +1231 StrInt, +1846 Sta, +554 Haste, +554 Mastery }
Local Wrists Toravon's Whiteout Bindings
ilevel: 910, stats: { 341 Armor, +2010 Sta, +1340 Str, +551 Haste, +413 Mastery }
Local Hands Fitted Ironbark Gauntlets
ilevel: 880, stats: { 456 Armor, +2026 Sta, +1351 StrInt, +748 Haste, +402 Mastery }
Local Finger1 Band of Callous Dominance
ilevel: 860, stats: { +1261 Sta, +1644 Crit, +658 Haste }, enchant: { +200 Haste }
Local Finger2 Terestian's Signet Ring
ilevel: 865, stats: { +1321 Sta, +1355 Haste, +1016 Crit }, enchant: { +200 Haste }
Local Trinket1 Kil'jaeden's Burning Wish
ilevel: 910, stats: { +2264 StrAgiInt, +408 Crit, +408 Mastery, +408 Haste }
Local Trinket2 Ursoc's Rending Paw
ilevel: 880, stats: { +1712 Str }
Local Back Drape of Vile Misfortune
ilevel: 870, stats: { 140 Armor, +923 StrAgiInt, +1385 Sta, +504 Mastery, +326 Crit }, enchant: { +200 Str }
Local Main Hand Blades of the Fallen Prince
ilevel: 902, weapon: { 5349 - 9936, 2.6 }, stats: { +947 Str, +1421 Sta, +362 Crit, +348 Mastery }, enchant: rune_of_razorice, relics: { +51 ilevels, +52 ilevels, +49 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 902, weapon: { 5349 - 9936, 2.6 }, stats: { +947 Str, +1421 Sta, +362 Crit, +348 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Bonerot"
origin="https://eu.api.battle.net/wow/character/hyjal/Bonerot/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/139/143875211-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=inscription=763/enchanting=794
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!1122110
artifact=12:0:0:0:0:108:1:109:3:110:3:111:3:113:3:114:3:115:3:117:3:119:1:120:1:122:1:123:1:124:1:1090:3:1091:1:1092:1:1332:1:1360:7
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/pillar_of_frost
actions+=/mind_freeze
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=buff.pillar_of_frost.up
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/use_item,slot=trinket1
actions+=/potion,name=old_war,if=buff.pillar_of_frost.up
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
actions+=/obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
actions+=/call_action_list,name=generic,if=!talent.breath_of_sindragosa.enabled&!(talent.gathering_storm.enabled&buff.remorseless_winter.remains)
actions+=/call_action_list,name=bos,if=talent.breath_of_sindragosa.enabled&!dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=bos_ticking,if=talent.breath_of_sindragosa.enabled&dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=gs_ticking,if=talent.gathering_storm.enabled&buff.remorseless_winter.remains&!talent.breath_of_sindragosa.enabled

actions.bos=frost_strike,if=talent.icy_talons.enabled&buff.icy_talons.remains<1.5&cooldown.breath_of_sindragosa.remains>6
actions.bos+=/remorseless_winter,if=talent.gathering_storm.enabled
actions.bos+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/breath_of_sindragosa,if=runic_power>=50
actions.bos+=/frost_strike,if=runic_power>=90&set_bonus.tier19_4pc
actions.bos+=/remorseless_winter,if=buff.rime.react&equipped.132459
actions.bos+=/howling_blast,if=buff.rime.react&(dot.remorseless_winter.ticking|cooldown.remorseless_winter.remains>1.5|!equipped.132459)
actions.bos+=/frost_strike,if=runic_power>=70
actions.bos+=/obliterate,if=!buff.rime.react
actions.bos+=/horn_of_winter,if=cooldown.breath_of_sindragosa.remains>15&runic_power<=70
actions.bos+=/frost_strike,if=cooldown.breath_of_sindragosa.remains>15
actions.bos+=/remorseless_winter,if=cooldown.breath_of_sindragosa.remains>10

actions.bos_ticking=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos_ticking+=/remorseless_winter,if=((runic_power>=20&set_bonus.tier19_4pc)|runic_power>=30)&buff.rime.react&(equipped.132459|talent.gathering_storm.enabled)
actions.bos_ticking+=/howling_blast,if=((runic_power>=20&set_bonus.tier19_4pc)|runic_power>=30)&buff.rime.react
actions.bos_ticking+=/obliterate,if=runic_power<=75|rune>3
actions.bos_ticking+=/horn_of_winter,if=runic_power<70&!dot.hungering_rune_weapon.ticking
actions.bos_ticking+=/hungering_rune_weapon,if=runic_power<30&!dot.hungering_rune_weapon.ticking
actions.bos_ticking+=/empower_rune_weapon,if=runic_power<20
actions.bos_ticking+=/remorseless_winter,if=talent.gathering_storm.enabled|!set_bonus.tier19_4pc|runic_power<30

actions.generic=frost_strike,if=!talent.shattering_strikes.enabled&(buff.icy_talons.remains<1.5&talent.icy_talons.enabled)
actions.generic+=/frost_strike,if=talent.shattering_strikes.enabled&debuff.razorice.stack=5
actions.generic+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/obliterate,if=equipped.132366&talent.runic_attenuation.enabled&set_bonus.tier19_2pc=1
actions.generic+=/remorseless_winter,if=(buff.rime.react&equipped.132459&!(buff.obliteration.up&spell_targets.howling_blast<2))|talent.gathering_storm.enabled
actions.generic+=/howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
actions.generic+=/frost_strike,if=runic_power.deficit<=10
actions.generic+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.generic+=/remorseless_winter,if=spell_targets.remorseless_winter>=2&!(talent.frostscythe.enabled&buff.killing_machine.react&spell_targets.frostscythe>=2)
actions.generic+=/frostscythe,if=(buff.killing_machine.react&spell_targets.frostscythe>=2)
actions.generic+=/glacial_advance,if=spell_targets.glacial_advance>=2
actions.generic+=/frostscythe,if=spell_targets.frostscythe>=3
actions.generic+=/obliterate,if=buff.killing_machine.react
actions.generic+=/obliterate
actions.generic+=/glacial_advance
actions.generic+=/horn_of_winter,if=!dot.hungering_rune_weapon.ticking
actions.generic+=/frost_strike
actions.generic+=/remorseless_winter,if=talent.frozen_pulse.enabled
actions.generic+=/empower_rune_weapon
actions.generic+=/hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking

actions.gs_ticking=frost_strike,if=buff.icy_talons.remains<1.5&talent.icy_talons.enabled
actions.gs_ticking+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.gs_ticking+=/howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
actions.gs_ticking+=/obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))
actions.gs_ticking+=/obliterate,if=rune>3|buff.killing_machine.react|buff.obliteration.up
actions.gs_ticking+=/frost_strike,if=runic_power>80|(buff.obliteration.up&!buff.killing_machine.react)
actions.gs_ticking+=/obliterate
actions.gs_ticking+=/horn_of_winter,if=runic_power<70&!dot.hungering_rune_weapon.ticking
actions.gs_ticking+=/glacial_advance
actions.gs_ticking+=/frost_strike
actions.gs_ticking+=/hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking
actions.gs_ticking+=/empower_rune_weapon

head=insurmountable_skullfortress,id=137445,bonus_id=3418/1532/3337
neck=anshes_pendant,id=139101,bonus_id=3474/1507/1674,enchant=mark_of_the_hidden_satyr
shoulders=crusaders_inferno_pauldrons,id=140021
back=drape_of_vile_misfortune,id=137530,bonus_id=3416/1522/3336,enchant=200str
chest=dreadwyrm_breastplate,id=138349,bonus_id=3514/1472/1813
wrists=toravons_whiteout_bindings,id=132458,bonus_id=3459/3458
hands=fitted_ironbark_gauntlets,id=139225,bonus_id=1805/1502/3337
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1807/1492/3337
legs=tassets_of_perpetual_despair,id=142127,bonus_id=3453/1472
feet=sabatons_of_the_illidari_crusade,id=140014
finger1=band_of_callous_dominance,id=134528,bonus_id=3414/1512/3336,enchant=200haste
finger2=terestians_signet_ring,id=142172,bonus_id=3453/1477/3336,enchant=200haste
trinket1=kiljaedens_burning_wish,id=144259,bonus_id=3459/3458
trinket2=ursocs_rending_paw,id=139328,bonus_id=1806/1502
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=137340/142192/139250/0,relic_id=3417:1527:3337/3452:1497:3337/1805:1492:3336/0,enchant=rune_of_razorice
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=878.06
# gear_strength=18392
# gear_stamina=25002
# gear_crit_rating=7139
# gear_haste_rating=9877
# gear_mastery_rating=3531
# gear_armor=4288

Decalang

Decalang : 430182 dps

  • Race: Draenei
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
430182.1 430182.1 254.5 / 0.059% 51253.2 / 11.9% 54807.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.8 7.8 Runic Power 15.45% 47.7 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Decalang/advanced
Talents
  • 15: Icy Talons (Frost Death Knight)
  • 30: Frozen Pulse (Frost Death Knight)
  • 45: Icecap (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: Permafrost (Frost Death Knight)
  • 90: Runic Attenuation (Frost Death Knight)
  • 100: Obliteration (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • mining: 800
  • jewelcrafting: 797

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Decalang 430182
auto_attack_mh 19563 4.5% 220.3 1.37sec 26690 19586 Direct 220.3 25365 50735 26690 24.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.30 220.30 0.00 0.00 1.3627 0.0000 5879993.75 8644147.78 31.98 19586.27 19586.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.07 56.77% 25364.55 21984 28177 25367.37 24549 26254 3172353 4663659 31.98
crit 53.37 24.22% 50734.72 43969 56355 50740.21 48200 53507 2707641 3980489 31.98
miss 41.86 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9797 2.3% 220.3 1.37sec 13367 9809 Direct 220.3 12703 25409 13367 24.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.30 220.30 0.00 0.00 1.3627 0.0000 2944789.25 4329119.14 31.98 9809.10 9809.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.96 56.72% 12703.35 10992 14089 12704.95 12300 13122 1587419 2333656 31.98
crit 53.42 24.25% 25408.85 21984 28177 25411.56 24357 26774 1357370 1995463 31.98
miss 41.92 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Crystalline Swords 20766 4.8% 70.0 8.50sec 89203 0 Direct 66.4 75748 151499 94139 24.3% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.03 66.36 0.00 0.00 0.0000 0.0000 6246573.04 6246573.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.25 75.72% 75747.93 59522 90357 75754.33 70221 81233 3806071 3806071 0.00
crit 16.11 24.28% 151499.22 119044 180713 151504.95 123509 173411 2440502 2440502 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Frost Fever 14243 (22004) 3.3% (5.1%) 34.4 8.90sec 192556 0 Periodic 99.9 34498 68999 42883 24.3% 0.0% 99.3%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.37 0.00 99.91 99.91 0.0000 2.9915 4284285.57 4284285.57 0.00 22142.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.6 75.70% 34498.47 12 41413 34507.50 32704 36301 2608934 2608934 0.00
crit 24.3 24.30% 68999.12 21 82827 69016.93 60273 78365 1675352 1675352 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Hypothermia 7761 1.8% 10.0 26.45sec 233996 0 Direct 10.0 188465 376602 233984 24.2% 0.0%  

Stats details: hypothermia

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.97 9.97 0.00 0.00 0.0000 0.0000 2333449.91 2333449.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.56 75.80% 188465.22 148805 225891 188347.62 0 225891 1424645 1424645 0.00
crit 2.41 24.20% 376602.30 297610 451783 342359.90 0 451783 908805 908805 0.00
 
 

Action details: hypothermia

Static Values
  • id:228322
  • school:frost
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228322
  • name:Hypothermia
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage.
 
Frost Strike 0 (105495) 0.0% (24.5%) 94.3 3.18sec 335982 296079

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.33 0.00 0.00 0.00 1.1348 0.0000 0.00 0.00 0.00 296079.49 296079.49
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.icy_talons.enabled&buff.icy_talons.remains<1.5&cooldown.breath_of_sindragosa.remains>6
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 62042 14.4% 94.3 3.18sec 197592 0 Direct 94.3 159024 318176 197594 24.2% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.33 94.33 0.00 0.00 0.0000 0.0000 18638145.53 18638145.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.47 75.77% 159024.15 131256 184194 159058.53 152309 166943 11365138 11365138 0.00
crit 22.86 24.23% 318175.83 262513 368388 318128.77 288705 346007 7273007 7273007 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
    Frost Strike Off-Hand 43454 10.1% 94.3 3.18sec 138390 0 Direct 94.3 111361 222772 138393 24.3% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.33 94.33 0.00 0.00 0.0000 0.0000 13053907.51 13053907.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.44 75.74% 111360.89 91883 128939 111383.74 106432 117492 7955807 7955807 0.00
crit 22.88 24.26% 222772.43 183766 257879 222785.92 201118 246974 5098100 5098100 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
Frozen Pulse 47399 11.0% 276.9 1.80sec 51514 0 Direct 276.9 41462 82906 51515 24.3% 0.0%  

Stats details: frozen_pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.85 276.85 0.00 0.00 0.0000 0.0000 14261779.15 14261779.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 209.70 75.74% 41461.94 32739 49698 41471.38 39305 43707 8694511 8694511 0.00
crit 67.15 24.26% 82905.90 65477 99396 82922.68 76818 89944 5567268 5567268 0.00
 
 

Action details: frozen_pulse

Static Values
  • id:195750
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195750
  • name:Frozen Pulse
  • school:frost
  • tooltip:
  • description:{$@spelldesc194909=While you have fewer than $m2 full $LRune:Runes;, your auto attacks radiate intense cold, inflicting {$195750s1=1} Frost damage on all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.660000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Howling Blast 45459 10.6% 34.4 8.90sec 397187 351943 Direct 34.4 319696 638652 397186 24.3% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.37 34.37 0.00 0.00 1.1286 0.0000 13650452.29 13650452.29 0.00 351942.77 351942.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.02 75.71% 319696.08 53198 452234 319248.08 247986 377018 8317982 8317982 0.00
crit 8.35 24.29% 638651.95 106396 904469 637386.02 0 904469 5332470 5332470 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Mark of the Hidden Satyr 7705 1.8% 19.1 15.76sec 120970 0 Direct 19.1 97354 194494 120975 24.3% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.13 19.13 0.00 0.00 0.0000 0.0000 2314641.01 2314641.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.48 75.69% 97353.91 80622 111261 97337.83 86119 108256 1409890 1409890 0.00
crit 4.65 24.31% 194494.44 161244 222522 193090.02 0 222522 904751 904751 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Obliterate 0 (94760) 0.0% (22.0%) 81.8 3.68sec 347894 308387

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.78 0.00 0.00 0.00 1.1281 0.0000 0.00 0.00 0.00 308386.95 308386.95
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.rime.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 55747 13.0% 81.8 3.68sec 204661 0 Direct 81.8 109058 271831 204664 58.7% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.78 81.78 0.00 0.00 0.0000 0.0000 16737431.61 24605609.88 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.75 41.27% 109058.05 94536 120604 109071.49 102009 115802 3680398 5410533 31.98
crit 48.03 58.73% 271831.02 234450 299097 271887.14 256264 284212 13057034 19195077 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.56
 
    Obliterate Off-Hand 39012 9.1% 81.8 3.68sec 143233 0 Direct 81.8 76336 190300 143232 58.7% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.78 81.78 0.00 0.00 0.0000 0.0000 11713731.90 17220295.45 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.78 41.30% 76336.02 66178 84425 76346.33 72285 81544 2578270 3790301 31.98
crit 48.01 58.70% 190300.32 164121 209374 190343.94 180529 199027 9135462 13429994 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.56
 
Pepper Breath 4263 1.0% 15.2 19.57sec 84217 0 Periodic 75.6 16961 0 16961 0.0% 0.0% 6.3%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 75.63 75.57 0.0000 0.2496 1281696.38 1281696.38 0.00 67904.44 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.6 100.00% 16960.57 68 16990 16962.28 16450 16990 1281696 1281696 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Potion of the Old War 13887 3.2% 26.4 3.33sec 155533 0 Direct 26.4 125278 250555 155533 24.2% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.41 26.41 0.00 0.00 0.0000 0.0000 4108289.94 6039575.36 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.04 75.85% 125277.65 125278 125278 125277.65 125278 125278 2509938 3689847 31.98
crit 6.38 24.15% 250555.29 250555 250555 250254.60 0 250555 1598352 2349729 31.94
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Razorice 11165 2.6% 354.5 0.85sec 9462 0 Direct 354.5 7616 15232 9462 24.2% 0.0%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 354.53 354.53 0.00 0.00 0.0000 0.0000 3354513.37 3354513.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 268.61 75.76% 7616.41 6268 8837 7617.74 7383 7877 2045803 2045803 0.00
crit 85.92 24.24% 15231.52 12536 17673 15234.22 14384 16241 1308710 1308710 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Remorseless Winter 0 (12101) 0.0% (2.8%) 12.8 24.01sec 285350 249554

Stats details: remorseless_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 0.00 0.00 0.00 1.1435 0.0000 0.00 0.00 0.00 249554.21 249554.21
 
 

Action details: remorseless_winter

Static Values
  • id:196770
  • school:frost
  • resource:rune
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.gathering_storm.enabled
Spelldata
  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
 
    Remorseless Winter (_damage) 10815 2.5% 100.5 2.88sec 32355 0 Direct 100.5 26038 52074 32355 24.3% 0.0%  

Stats details: remorseless_winter_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.52 100.52 0.00 0.00 0.0000 0.0000 3252214.76 3252214.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.13 75.74% 26038.26 20535 31173 26039.33 23709 28258 1982253 1982253 0.00
crit 24.39 24.26% 52073.92 41070 62346 52071.15 44407 58790 1269962 1269962 0.00
 
 

Action details: remorseless_winter_damage

Static Values
  • id:196771
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.}
 
    Frozen Soul 1286 0.3% 12.4 24.01sec 31275 0 Direct 12.4 25169 50371 31277 24.2% 0.0%  

Stats details: frozen_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.37 12.37 0.00 0.00 0.0000 0.0000 386784.69 386784.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.37 75.77% 25168.66 19842 30121 25169.15 20586 30121 235842 235842 0.00
crit 3.00 24.23% 50371.46 39685 60241 48498.71 0 60241 150943 150943 0.00
 
 

Action details: frozen_soul

Static Values
  • id:204959
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204959
  • name:Frozen Soul
  • school:frost
  • tooltip:
  • description:{$@spelldesc189184=When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Flesh 7742 1.8% 37.9 7.95sec 61474 0 Periodic 117.1 16021 31993 19894 24.2% 0.0% 77.8%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.88 0.00 117.05 117.05 0.0000 2.0000 2328695.49 2328695.49 0.00 9947.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.7 75.75% 16021.23 12615 47633 15999.55 13135 20322 1420642 1420642 0.00
crit 28.4 24.25% 31993.38 25229 94233 31950.82 25650 44020 908053 908053 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Sindragosa's Fury 8077 1.9% 1.3 316.96sec 1867472 1896734 Direct 1.3 1504407 3008816 1867708 24.1% 0.0%  

Stats details: sindragosas_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.32 1.32 0.00 0.00 0.9849 0.0000 2473340.50 2473340.50 0.00 1896733.51 1896733.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 75.87% 1504406.81 1140854 1505942 1227864.26 0 1505942 1511628 1511628 0.00
crit 0.32 24.13% 3008815.67 2619040 3011885 901927.09 0 3011885 961712 961712 0.00
 
 

Action details: sindragosas_fury

Static Values
  • id:190778
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
Spelldata
  • id:190778
  • name:Sindragosa's Fury
  • school:frost
  • tooltip:
  • description:Summons Sindragosa, who breathes frost on all enemies within {$s1=40} yd in front of you, dealing {$190780s1=0} Frost damage and slowing movement speed by {$190780s2=50}% for {$190780d=10 seconds}.
 
Simple Action Stats Execute Interval
Decalang
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.0 190.53sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<20
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
Obliteration 3.6 93.10sec

Stats details: obliteration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: obliteration

Static Values
  • id:207256
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
Spelldata
  • id:207256
  • name:Obliteration
  • school:physical
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
 
Pillar of Frost 7.1 46.64sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rend Flesh (rending_flesh_trigger) 37.9 7.95sec

Stats details: rending_flesh_trigger

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rending_flesh_trigger

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:46549.49
  • base_dd_max:46549.49
 
Unholy Strength 23.0 13.14sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 22.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 16.67% 0.0(0.0) 1.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Frozen Pulse 67.6 0.0 4.4sec 4.4sec 77.80% 77.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_frozen_pulse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frozen_pulse_1:77.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194909
  • name:Frozen Pulse
  • tooltip:
  • description:While you have fewer than $m2 full $LRune:Runes;, your auto attacks radiate intense cold, inflicting {$195750s1=1} Frost damage on all nearby enemies.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Frozen Soul 12.7 0.0 24.0sec 24.0sec 33.36% 33.36% 0.0(0.0) 12.4

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_frozen_soul
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • frozen_soul_1:33.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:189184
  • name:Frozen Soul
  • tooltip:
  • description:When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icy Talons 3.5 90.8 81.7sec 3.2sec 98.56% 95.33% 84.0(84.0) 2.6

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • icy_talons_1:4.35%
  • icy_talons_2:3.76%
  • icy_talons_3:90.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$s1=10}%.
  • description:{$@spelldesc194878=Frost Strike also increases your melee attack speed by {$194879s1=10}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 37.5 5.5 8.0sec 7.0sec 26.41% 45.57% 5.5(5.5) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:26.41%

Trigger Attempt Success

  • trigger_pct:40.59%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Obliteration 3.6 0.0 93.1sec 93.1sec 9.40% 12.25% 0.0(0.0) 3.5

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207256
  • name:Obliteration
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:100.00%
Pillar of Frost 7.1 0.0 45.8sec 46.7sec 45.61% 44.89% 0.0(0.0) 6.6

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:45.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 59.7sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Remorseless Winter 12.8 0.0 24.0sec 24.0sec 33.48% 33.48% 100.5(100.5) 12.4

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • remorseless_winter_1:33.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 33.3 3.5 9.0sec 8.1sec 23.59% 96.00% 3.5(3.5) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:23.59%

Trigger Attempt Success

  • trigger_pct:45.01%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 8.8 14.2 35.6sec 13.2sec 72.15% 70.11% 14.2(14.2) 8.1

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:72.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Killing Machine: Obliterate 37.2 8.0sec
Rune ready 158.3 2.3sec

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=79690)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.2351.323 / 0.9123.64611.840
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
3.0034.90810.534 / 8.86422.00750.119

Resources

Resource Usage Type Count Total Average RPE APR
Decalang
frost_strike Runic Power 94.3 2358.2 25.0 25.0 13439.3
howling_blast Rune 34.4 1.3 0.0 0.0 10306328.4
obliterate Rune 81.8 149.4 1.8 1.8 190404.9
remorseless_winter Rune 12.8 12.8 1.0 1.0 285345.2
Resource Gains Type Count Total Average Overflow
remorseless_winter Runic Power 12.75 127.39 (5.34%) 9.99 0.14 0.11%
obliterate Runic Power 81.78 1635.09 (68.56%) 19.99 0.52 0.03%
Frost Fever Runic Power 17.63 88.00 (3.69%) 4.99 0.14 0.16%
Rune Regeneration Rune 111.98 111.98 (70.74%) 1.00 0.00 0.00%
Runic Empowerment Rune 35.44 35.44 (22.39%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 10.88 10.88 (6.88%) 1.00 0.00 0.00%
Runic Attenuation Runic Power 440.61 439.94 (18.45%) 1.00 0.67 0.15%
Over-Powered Runic Power 8.18 81.38 (3.41%) 9.95 0.44 0.54%
Howling Blast Runic Power 1.32 13.24 (0.56%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 7.93 7.84
Rune 0.53 0.54
Combat End Resource Mean Min Max
Runic Power 26.96 0.00 99.00
Rune 0.79 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data Decalang Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Decalang Damage Per Second
Count 9999
Mean 430182.14
Minimum 386474.05
Maximum 482135.91
Spread ( max - min ) 95661.86
Range [ ( max - min ) / 2 * 100% ] 11.12%
Standard Deviation 12983.1990
5th Percentile 409426.54
95th Percentile 452191.70
( 95th Percentile - 5th Percentile ) 42765.16
Mean Distribution
Standard Deviation 129.8385
95.00% Confidence Intervall ( 429927.66 - 430436.62 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3500
0.1 Scale Factor Error with Delta=300 1438955
0.05 Scale Factor Error with Delta=300 5755819
0.01 Scale Factor Error with Delta=300 143895461
Priority Target DPS
Sample Data Decalang Priority Target Damage Per Second
Count 9999
Mean 430182.14
Minimum 386474.05
Maximum 482135.91
Spread ( max - min ) 95661.86
Range [ ( max - min ) / 2 * 100% ] 11.12%
Standard Deviation 12983.1990
5th Percentile 409426.54
95th Percentile 452191.70
( 95th Percentile - 5th Percentile ) 42765.16
Mean Distribution
Standard Deviation 129.8385
95.00% Confidence Intervall ( 429927.66 - 430436.62 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3500
0.1 Scale Factor Error with Delta=300 1438955
0.05 Scale Factor Error with Delta=300 5755819
0.01 Scale Factor Error with Delta=300 143895461
DPS(e)
Sample Data Decalang Damage Per Second (Effective)
Count 9999
Mean 430182.14
Minimum 386474.05
Maximum 482135.91
Spread ( max - min ) 95661.86
Range [ ( max - min ) / 2 * 100% ] 11.12%
Damage
Sample Data Decalang Damage
Count 9999
Mean 129244715.65
Minimum 94594564.29
Maximum 166323599.05
Spread ( max - min ) 71729034.76
Range [ ( max - min ) / 2 * 100% ] 27.75%
DTPS
Sample Data Decalang Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Decalang Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Decalang Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Decalang Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Decalang Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Decalang Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DecalangTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Decalang Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 7.06 pillar_of_frost
0.00 mind_freeze
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=buff.pillar_of_frost.up
0.00 berserking,if=buff.pillar_of_frost.up
7 1.00 potion,name=old_war,if=buff.pillar_of_frost.up
8 1.32 sindragosas_fury,if=buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
9 3.56 obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
A 0.00 call_action_list,name=generic,if=!talent.breath_of_sindragosa.enabled&!(talent.gathering_storm.enabled&buff.remorseless_winter.remains)
B 0.00 call_action_list,name=bos,if=talent.breath_of_sindragosa.enabled&!dot.breath_of_sindragosa.ticking
C 0.00 call_action_list,name=bos_ticking,if=talent.breath_of_sindragosa.enabled&dot.breath_of_sindragosa.ticking
D 0.00 call_action_list,name=gs_ticking,if=talent.gathering_storm.enabled&buff.remorseless_winter.remains&!talent.breath_of_sindragosa.enabled
actions.generic
# count action,conditions
E 25.23 frost_strike,if=!talent.shattering_strikes.enabled&(buff.icy_talons.remains<1.5&talent.icy_talons.enabled)
0.00 frost_strike,if=talent.shattering_strikes.enabled&debuff.razorice.stack=5
F 1.52 howling_blast,target_if=!dot.frost_fever.ticking
0.00 obliterate,if=equipped.132366&talent.runic_attenuation.enabled&set_bonus.tier19_2pc=1
G 5.63 remorseless_winter,if=(buff.rime.react&equipped.132459&!(buff.obliteration.up&spell_targets.howling_blast<2))|talent.gathering_storm.enabled
H 32.84 howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
I 0.75 frost_strike,if=runic_power.deficit<=10
J 10.72 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2&!(talent.frostscythe.enabled&buff.killing_machine.react&spell_targets.frostscythe>=2)
0.00 frostscythe,if=(buff.killing_machine.react&spell_targets.frostscythe>=2)
0.00 glacial_advance,if=spell_targets.glacial_advance>=2
0.00 frostscythe,if=spell_targets.frostscythe>=3
K 32.77 obliterate,if=buff.killing_machine.react
L 49.01 obliterate
0.00 glacial_advance
0.00 horn_of_winter,if=!dot.hungering_rune_weapon.ticking
M 57.62 frost_strike
N 7.12 remorseless_winter,if=talent.frozen_pulse.enabled
O 1.99 empower_rune_weapon
0.00 hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking

Sample Sequence

02456FLEL8GHELHMKM9OLJKJKJKJKHLHELMLHMMNMLHMLMLM6LELEMLGHE7LEHMLHMLMKHMNMKMLMKE6KEHNMKHEKHMMKM9LJKJKMGHMKMKMLEM6KMLMNMKHELHEKHEMNLELMLEHMKHMLGH6ELMLMOKHLEHLMLMLGHEMKMLMLHLEHLIMMLHMLM9J6KLKEKGHEKLIMMKHLEMMLMHKMNMLHKEHMLHL6EMLHLEMNKEHKEHLMLHL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre precombat 2 augmentation Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre precombat 4 potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 default 6 pillar_of_frost Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune bloodlust, unholy_strength, potion_of_the_old_war
0:00.000 generic F howling_blast Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:00.912 generic L obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 5.0/6: 83% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:01.824 generic E frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:02.735 generic L obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 3.0/6: 50% rune bloodlust, icy_talons, killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:03.647 default 8 sindragosas_fury Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune bloodlust, icy_talons, pillar_of_frost, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
0:04.558 generic G remorseless_winter Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune bloodlust, icy_talons, pillar_of_frost, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
0:05.469 generic H howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune bloodlust, icy_talons, pillar_of_frost, rime, unholy_strength, frozen_pulse, remorseless_winter, potion_of_the_old_war
0:06.381 generic E frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune bloodlust, icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:07.294 generic L obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(2), pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
0:08.204 generic H howling_blast Fluffy_Pillow 44.0/100: 44% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(2), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:09.113 generic M frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(2), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:10.026 generic K obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
0:10.936 generic M frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:11.848 default 9 obliteration Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:11.848 generic O empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:11.848 generic L obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
0:12.760 generic J frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, frozen_soul, potion_of_the_old_war
0:13.669 generic K obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:14.581 generic J frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:15.493 generic K obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:16.405 generic J frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:17.316 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:18.228 generic J frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:19.139 generic K obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:20.051 generic H howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), rime, unholy_strength, potion_of_the_old_war
0:20.962 generic L obliterate Fluffy_Pillow 43.0/100: 43% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, potion_of_the_old_war
0:21.873 generic H howling_blast Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), rime, unholy_strength, potion_of_the_old_war
0:22.786 generic E frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, potion_of_the_old_war
0:23.698 generic L obliterate Fluffy_Pillow 42.0/100: 42% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength
0:24.611 generic M frost_strike Fluffy_Pillow 64.0/100: 64% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:25.523 generic L obliterate Fluffy_Pillow 41.0/100: 41% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength
0:26.435 generic H howling_blast Fluffy_Pillow 63.0/100: 63% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), rime, unholy_strength, frozen_pulse
0:27.348 generic M frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:28.261 generic M frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:29.173 generic N remorseless_winter Fluffy_Pillow 17.0/100: 17% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:30.084 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, remorseless_winter
0:30.994 Waiting     0.300 sec 6.0/100: 6% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:31.294 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
0:32.205 generic H howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:33.116 generic M frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:34.029 generic L obliterate Fluffy_Pillow 7.0/100: 7% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
0:34.940 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:35.851 Waiting     1.500 sec 4.0/100: 4% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), frozen_pulse, frozen_soul, remorseless_winter
0:37.351 generic L obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), frozen_soul
0:38.261 generic M frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), frozen_pulse
0:39.172 Waiting     0.600 sec 7.0/100: 7% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), frozen_pulse
0:39.772 default 6 pillar_of_frost Fluffy_Pillow 7.0/100: 7% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), frozen_pulse
0:40.000 Waiting     2.800 sec 7.0/100: 7% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
0:42.800 generic L obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
0:43.984 generic E frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse
0:45.169 Waiting     2.300 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
0:47.469 generic L obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost
0:48.653 generic E frost_strike Fluffy_Pillow 49.0/100: 49% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse
0:49.836 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
0:51.019 generic L obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
0:52.202 generic G remorseless_winter Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse
0:53.385 generic H howling_blast Fluffy_Pillow 37.0/100: 37% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:54.568 generic E frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:55.752 Waiting     2.000 sec 16.0/100: 16% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:57.752 default 7 potion Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:58.000 Waiting     0.500 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
0:58.500 generic L obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
0:59.685 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:00.868 generic H howling_blast Fluffy_Pillow 22.0/100: 22% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, potion_of_the_old_war
1:02.051 Waiting     0.700 sec 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
1:02.751 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
1:03.935 generic L obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, potion_of_the_old_war
1:05.117 generic H howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse, potion_of_the_old_war
1:06.299 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
1:07.480 Waiting     0.500 sec 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
1:07.980 generic L obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, potion_of_the_old_war
1:09.164 generic M frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, potion_of_the_old_war
1:10.347 Waiting     0.800 sec 11.0/100: 11% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, potion_of_the_old_war
1:11.147 generic K obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, potion_of_the_old_war
1:12.331 generic H howling_blast Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
1:13.515 generic M frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, potion_of_the_old_war
1:14.698 generic N remorseless_winter Fluffy_Pillow 12.0/100: 12% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, potion_of_the_old_war
1:15.881 Waiting     0.900 sec 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:16.781 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:17.965 Waiting     1.000 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:18.965 generic K obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
1:20.148 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:21.331 Waiting     0.800 sec 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:22.131 generic L obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
1:23.315 generic M frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul
1:24.496 Waiting     2.300 sec 11.0/100: 11% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
1:26.796 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
1:27.980 generic E frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
1:29.164 Waiting     0.600 sec 12.0/100: 12% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse
1:29.764 default 6 pillar_of_frost Fluffy_Pillow 14.0/100: 14% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse
1:30.000 Waiting     1.600 sec 14.0/100: 14% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse
1:31.600 generic K obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost
1:32.784 generic E frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, rime, frozen_pulse
1:33.968 generic H howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, rime, frozen_pulse
1:35.151 generic N remorseless_winter Fluffy_Pillow 22.0/100: 22% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse
1:36.334 generic M frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
1:37.518 Waiting     1.900 sec 9.0/100: 9% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
1:39.418 generic K obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_soul, remorseless_winter
1:40.600 generic H howling_blast Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse, frozen_soul, remorseless_winter
1:41.784 generic E frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
1:42.968 generic K obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_soul, remorseless_winter
1:44.151 generic H howling_blast Fluffy_Pillow 49.0/100: 49% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse
1:45.334 generic M frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
1:46.519 generic M frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
1:47.701 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength
1:48.884 generic M frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
1:50.068 default 9 obliteration Fluffy_Pillow 12.0/100: 12% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
1:50.068 Waiting     0.400 sec 12.0/100: 12% runic_power | 0.0/6: 0% rune icy_talons(3), obliteration, unholy_strength, frozen_pulse
1:50.468 generic L obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, unholy_strength, frozen_pulse
1:51.652 generic J frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 0.0/6: 0% rune icy_talons(3), obliteration, rime, unholy_strength, frozen_pulse
1:52.835 Waiting     0.700 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength, frozen_pulse
1:53.535 generic K obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength, frozen_pulse
1:54.718 generic J frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune icy_talons(3), obliteration, rime, unholy_strength, frozen_pulse
1:55.901 generic K obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength, frozen_pulse
1:57.084 generic M frost_strike Fluffy_Pillow 47.0/100: 47% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength, frozen_pulse
1:58.269 generic G remorseless_winter Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
1:59.453 generic H howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:00.636 generic M frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:01.817 Waiting     1.200 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:03.017 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
2:04.201 generic M frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:05.383 Waiting     0.800 sec 14.0/100: 14% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:06.183 generic K obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
2:07.366 generic M frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:08.550 Waiting     2.300 sec 13.0/100: 13% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:10.850 generic L obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:12.036 generic E frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
2:13.220 generic M frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:14.403 default 6 pillar_of_frost Fluffy_Pillow 13.0/100: 13% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, unholy_strength
2:14.403 generic K obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength
2:15.586 generic M frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:16.771 Waiting     0.400 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:17.171 generic L obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
2:18.355 generic M frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:19.540 generic N remorseless_winter Fluffy_Pillow 9.0/100: 9% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
2:20.725 Waiting     2.100 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:22.825 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:24.009 Waiting     1.000 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:25.009 generic K obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
2:26.194 generic H howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:27.376 generic E frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:28.561 Waiting     1.200 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:29.761 generic L obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
2:30.943 generic H howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse
2:32.126 generic E frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse
2:33.308 Waiting     1.200 sec 14.0/100: 14% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
2:34.508 generic K obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine
2:35.692 generic H howling_blast Fluffy_Pillow 48.0/100: 48% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
2:36.875 generic E frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse
2:38.057 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
2:39.240 Waiting     0.100 sec 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
2:39.340 generic N remorseless_winter Fluffy_Pillow 2.0/100: 2% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
2:40.724 Waiting     1.600 sec 14.0/100: 14% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse, frozen_soul, remorseless_winter
2:42.324 generic L obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune icy_talons(3), frozen_soul, remorseless_winter
2:43.508 generic E frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse, frozen_soul, remorseless_winter
2:44.692 Waiting     0.800 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:45.492 generic L obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
2:46.676 generic M frost_strike Fluffy_Pillow 44.0/100: 44% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:47.860 Waiting     2.300 sec 19.0/100: 19% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul
2:50.160 generic L obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
2:51.345 generic E frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
2:52.528 generic H howling_blast Fluffy_Pillow 22.0/100: 22% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
2:53.714 Waiting     1.400 sec 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:55.114 generic M frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:56.298 Waiting     0.200 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
2:56.498 generic K obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
2:57.679 generic H howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
2:58.863 generic M frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
3:00.048 generic L obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune icy_talons(3)
3:01.233 generic G remorseless_winter Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune icy_talons(3), rime, frozen_pulse
3:02.417 generic H howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:03.601 default 6 pillar_of_frost Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:03.601 generic E frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:04.784 generic L obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
3:05.968 generic M frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:07.152 Waiting     1.900 sec 12.0/100: 12% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:09.052 generic L obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
3:10.236 generic M frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
3:11.419 Waiting     0.200 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
3:11.619 generic O empower_rune_weapon Fluffy_Pillow 13.0/100: 13% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
3:11.848 generic K obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 6.0/6: 100% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength
3:13.031 generic H howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 4.0/6: 67% rune icy_talons(3), pillar_of_frost, rime, unholy_strength
3:14.213 generic L obliterate Fluffy_Pillow 37.0/100: 37% runic_power | 4.0/6: 67% rune icy_talons(3), pillar_of_frost, unholy_strength
3:15.396 generic E frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, rime, unholy_strength
3:16.580 generic H howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, rime, unholy_strength
3:17.764 generic L obliterate Fluffy_Pillow 38.0/100: 38% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
3:18.948 generic M frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse
3:20.133 generic L obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 3.0/6: 50% rune icy_talons(3), pillar_of_frost
3:21.317 generic M frost_strike Fluffy_Pillow 67.0/100: 67% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
3:22.499 generic L obliterate Fluffy_Pillow 44.0/100: 44% runic_power | 3.0/6: 50% rune icy_talons(3), pillar_of_frost
3:23.683 generic G remorseless_winter Fluffy_Pillow 76.0/100: 76% runic_power | 1.0/6: 17% rune icy_talons(3), rime, frozen_pulse
3:24.867 generic H howling_blast Fluffy_Pillow 88.0/100: 88% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, frozen_pulse, frozen_soul, remorseless_winter
3:26.051 generic E frost_strike Fluffy_Pillow 90.0/100: 90% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
3:27.234 generic M frost_strike Fluffy_Pillow 65.0/100: 65% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
3:28.418 generic K obliterate Fluffy_Pillow 42.0/100: 42% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, frozen_soul, remorseless_winter
3:29.602 generic M frost_strike Fluffy_Pillow 74.0/100: 74% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse, frozen_soul, remorseless_winter
3:30.785 generic L obliterate Fluffy_Pillow 51.0/100: 51% runic_power | 3.0/6: 50% rune icy_talons(3), frozen_soul, remorseless_winter
3:31.969 generic M frost_strike Fluffy_Pillow 73.0/100: 73% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse, frozen_soul
3:33.153 generic L obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune icy_talons(3)
3:34.336 generic H howling_blast Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
3:35.521 generic L obliterate Fluffy_Pillow 72.0/100: 72% runic_power | 2.0/6: 33% rune icy_talons(3)
3:36.705 generic E frost_strike Fluffy_Pillow 94.0/100: 94% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:37.891 generic H howling_blast Fluffy_Pillow 71.0/100: 71% runic_power | 2.0/6: 33% rune icy_talons(3), rime, unholy_strength
3:39.075 generic L obliterate Fluffy_Pillow 73.0/100: 73% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:40.260 generic I frost_strike Fluffy_Pillow 95.0/100: 95% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:41.443 generic M frost_strike Fluffy_Pillow 72.0/100: 72% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:42.626 generic M frost_strike Fluffy_Pillow 47.0/100: 47% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:43.809 generic L obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
3:44.992 generic H howling_blast Fluffy_Pillow 46.0/100: 46% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:46.176 generic M frost_strike Fluffy_Pillow 48.0/100: 48% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:47.359 generic L obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:48.542 generic M frost_strike Fluffy_Pillow 47.0/100: 47% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:49.728 default 9 obliteration Fluffy_Pillow 22.0/100: 22% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:49.728 Waiting     1.500 sec 22.0/100: 22% runic_power | 0.0/6: 0% rune icy_talons(3), obliteration, unholy_strength, frozen_pulse
3:51.228 generic J frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, unholy_strength
3:52.410 default 6 pillar_of_frost Fluffy_Pillow 1.0/100: 1% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, obliteration, unholy_strength
3:52.410 generic K obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength
3:53.594 generic L obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 3.0/6: 50% rune icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength
3:54.778 generic K obliterate Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength
3:55.962 generic E frost_strike Fluffy_Pillow 77.0/100: 77% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, pillar_of_frost, rime, unholy_strength, frozen_pulse
3:57.144 generic K obliterate Fluffy_Pillow 54.0/100: 54% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, rime, unholy_strength
3:58.328 generic G remorseless_winter Fluffy_Pillow 76.0/100: 76% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, rime, unholy_strength, frozen_pulse
3:59.510 generic H howling_blast Fluffy_Pillow 86.0/100: 86% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, rime, unholy_strength, frozen_soul, remorseless_winter
4:00.695 generic E frost_strike Fluffy_Pillow 88.0/100: 88% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
4:01.881 generic K obliterate Fluffy_Pillow 65.0/100: 65% runic_power | 4.0/6: 67% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
4:03.066 generic L obliterate Fluffy_Pillow 87.0/100: 87% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
4:04.251 generic I frost_strike Fluffy_Pillow 100.0/100: 100% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:05.435 generic M frost_strike Fluffy_Pillow 77.0/100: 77% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:06.620 generic M frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul
4:07.804 generic K obliterate Fluffy_Pillow 29.0/100: 29% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength
4:08.989 generic H howling_blast Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse
4:10.171 generic L obliterate Fluffy_Pillow 53.0/100: 53% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
4:11.356 generic E frost_strike Fluffy_Pillow 85.0/100: 85% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
4:12.538 generic M frost_strike Fluffy_Pillow 67.0/100: 67% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
4:13.722 generic M frost_strike Fluffy_Pillow 44.0/100: 44% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
4:14.905 generic L obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength
4:16.088 generic M frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, rime, unholy_strength, frozen_pulse
4:17.272 generic H howling_blast Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, rime, unholy_strength
4:18.457 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, unholy_strength
4:19.641 generic M frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
4:20.823 generic N remorseless_winter Fluffy_Pillow 19.0/100: 19% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
4:22.008 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:23.191 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength, frozen_soul, remorseless_winter
4:24.373 generic H howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:25.556 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
4:26.739 generic E frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:27.922 generic H howling_blast Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:29.107 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse, frozen_soul
4:30.290 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune icy_talons(3)
4:31.473 generic H howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune icy_talons(3), rime
4:32.656 generic L obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine
4:33.840 default 6 pillar_of_frost Fluffy_Pillow 52.0/100: 52% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
4:33.840 generic E frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
4:35.024 generic M frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse
4:36.207 generic L obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
4:37.391 generic H howling_blast Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse
4:38.576 generic L obliterate Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
4:39.759 generic E frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
4:40.943 generic M frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
4:42.126 generic N remorseless_winter Fluffy_Pillow 4.0/100: 4% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
4:43.310 Waiting     3.000 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:46.310 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
4:47.493 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:48.675 generic H howling_blast Fluffy_Pillow 17.0/100: 17% runic_power | 0.0/6: 0% rune icy_talons, pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:49.860 Waiting     4.300 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:54.160 generic K obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 3.0/6: 50% rune killing_machine
4:55.344 generic E frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune rime, frozen_pulse
4:56.528 generic H howling_blast Fluffy_Pillow 22.0/100: 22% runic_power | 2.0/6: 33% rune icy_talons, rime
4:57.712 generic L obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 3.0/6: 50% rune icy_talons
4:58.895 generic M frost_strike Fluffy_Pillow 44.0/100: 44% runic_power | 1.0/6: 17% rune icy_talons, frozen_pulse
5:00.078 generic L obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune icy_talons(2)
5:01.261 generic H howling_blast Fluffy_Pillow 53.0/100: 53% runic_power | 0.0/6: 0% rune icy_talons(2), rime, frozen_pulse
5:02.446 generic L obliterate Fluffy_Pillow 55.0/100: 55% runic_power | 2.0/6: 33% rune icy_talons(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 29750 28044 16053 (10049)
Agility 8278 7953 0
Stamina 42728 42728 25868
Intellect 4751 4426 0
Spirit 2 2 0
Health 2563680 2563680 0
Runic Power 100 100 0
Rune 6 6 0
Crit 24.25% 24.25% 7701
Haste 27.15% 27.15% 10181
Swing Speed 42.41% 42.41% 10181
Damage / Heal Versatility 1.78% 1.78% 847
Attack Power 29750 28044 0
Mastery 31.12% 31.12% 5099
Armor 4725 4725 4295
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 876.00
Local Head Perseverance of the Ebon Martyr
ilevel: 910, stats: { 633 Armor, +3573 Sta, +2382 Str, +980 Haste, +735 Mastery }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1519 Sta, +1410 Mastery, +1188 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Greystone Pauldrons
ilevel: 855, stats: { 518 Armor, +1070 StrInt, +1605 Sta, +658 Haste, +389 Crit }, gems: { +150 Haste }
Local Chest Horror Inscribed Chestguard
ilevel: 875, stats: { 721 Armor, +2577 Sta, +1719 StrInt, +1075 Crit, +430 Haste }
Local Waist Eon-Tempered Waistplate
ilevel: 865, stats: { 397 Armor, +1761 Sta, +1174 StrInt, +706 Crit, +380 Mastery }
Local Legs Tassets of Perpetual Despair
ilevel: 880, stats: { 638 Armor, +1801 StrInt, +2702 Sta, +1096 Haste, +438 Crit }
Local Feet Trampling Warboots
ilevel: 880, stats: { 501 Armor, +2026 Sta, +1351 StrInt, +649 Mastery, +501 Haste }, gems: { +150 Haste }
Local Wrists Wristclamps of Mad Dreams
ilevel: 865, stats: { 309 Armor, +1320 Sta, +880 StrInt, +494 Crit, +320 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 865, stats: { 441 Armor, +1761 Sta, +1174 StrInt, +706 Haste, +380 Mastery }
Local Finger1 Terestian's Signet Ring
ilevel: 875, stats: { +1450 Sta, +1440 Haste, +1080 Crit }, enchant: { +200 Haste }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 870, stats: { +1385 Sta, +1677 Crit, +768 Haste }, enchant: { +200 Haste }
Local Trinket1 Ursoc's Rending Paw
ilevel: 870, stats: { +1560 Str }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +847 Vers, +847 Mastery, +847 Crit, +847 Haste }
Local Back Evergreen Vinewrap Drape
ilevel: 865, stats: { 137 Armor, +880 StrAgiInt, +1321 Sta, +547 Haste, +267 Crit }, enchant: { +150 Str }
Local Main Hand Blades of the Fallen Prince
ilevel: 903, weapon: { 5400 - 10030, 2.6 }, stats: { +956 Str, +1434 Sta, +364 Crit, +349 Mastery }, enchant: rune_of_razorice, relics: { +52 ilevels, +53 ilevels, +48 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 903, weapon: { 5400 - 10030, 2.6 }, stats: { +956 Str, +1434 Sta, +364 Crit, +349 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Decalang"
origin="https://eu.api.battle.net/wow/character/hyjal/Decalang/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/92/114541916-avatar.jpg"
level=110
race=draenei
role=attack
position=back
professions=jewelcrafting=797/mining=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!1102110
artifact=12:0:0:0:0:108:1:109:3:110:3:111:3:113:3:114:3:115:3:117:3:119:1:120:1:122:1:123:1:124:1:1090:3:1091:1:1092:1:1332:1:1360:4
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/pillar_of_frost
actions+=/mind_freeze
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=buff.pillar_of_frost.up
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/potion,name=old_war,if=buff.pillar_of_frost.up
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
actions+=/obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
actions+=/call_action_list,name=generic,if=!talent.breath_of_sindragosa.enabled&!(talent.gathering_storm.enabled&buff.remorseless_winter.remains)
actions+=/call_action_list,name=bos,if=talent.breath_of_sindragosa.enabled&!dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=bos_ticking,if=talent.breath_of_sindragosa.enabled&dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=gs_ticking,if=talent.gathering_storm.enabled&buff.remorseless_winter.remains&!talent.breath_of_sindragosa.enabled

actions.bos=frost_strike,if=talent.icy_talons.enabled&buff.icy_talons.remains<1.5&cooldown.breath_of_sindragosa.remains>6
actions.bos+=/remorseless_winter,if=talent.gathering_storm.enabled
actions.bos+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/breath_of_sindragosa,if=runic_power>=50
actions.bos+=/frost_strike,if=runic_power>=90&set_bonus.tier19_4pc
actions.bos+=/remorseless_winter,if=buff.rime.react&equipped.132459
actions.bos+=/howling_blast,if=buff.rime.react&(dot.remorseless_winter.ticking|cooldown.remorseless_winter.remains>1.5|!equipped.132459)
actions.bos+=/frost_strike,if=runic_power>=70
actions.bos+=/obliterate,if=!buff.rime.react
actions.bos+=/horn_of_winter,if=cooldown.breath_of_sindragosa.remains>15&runic_power<=70
actions.bos+=/frost_strike,if=cooldown.breath_of_sindragosa.remains>15
actions.bos+=/remorseless_winter,if=cooldown.breath_of_sindragosa.remains>10

actions.bos_ticking=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos_ticking+=/remorseless_winter,if=((runic_power>=20&set_bonus.tier19_4pc)|runic_power>=30)&buff.rime.react&(equipped.132459|talent.gathering_storm.enabled)
actions.bos_ticking+=/howling_blast,if=((runic_power>=20&set_bonus.tier19_4pc)|runic_power>=30)&buff.rime.react
actions.bos_ticking+=/obliterate,if=runic_power<=75|rune>3
actions.bos_ticking+=/horn_of_winter,if=runic_power<70&!dot.hungering_rune_weapon.ticking
actions.bos_ticking+=/hungering_rune_weapon,if=runic_power<30&!dot.hungering_rune_weapon.ticking
actions.bos_ticking+=/empower_rune_weapon,if=runic_power<20
actions.bos_ticking+=/remorseless_winter,if=talent.gathering_storm.enabled|!set_bonus.tier19_4pc|runic_power<30

actions.generic=frost_strike,if=!talent.shattering_strikes.enabled&(buff.icy_talons.remains<1.5&talent.icy_talons.enabled)
actions.generic+=/frost_strike,if=talent.shattering_strikes.enabled&debuff.razorice.stack=5
actions.generic+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/obliterate,if=equipped.132366&talent.runic_attenuation.enabled&set_bonus.tier19_2pc=1
actions.generic+=/remorseless_winter,if=(buff.rime.react&equipped.132459&!(buff.obliteration.up&spell_targets.howling_blast<2))|talent.gathering_storm.enabled
actions.generic+=/howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
actions.generic+=/frost_strike,if=runic_power.deficit<=10
actions.generic+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.generic+=/remorseless_winter,if=spell_targets.remorseless_winter>=2&!(talent.frostscythe.enabled&buff.killing_machine.react&spell_targets.frostscythe>=2)
actions.generic+=/frostscythe,if=(buff.killing_machine.react&spell_targets.frostscythe>=2)
actions.generic+=/glacial_advance,if=spell_targets.glacial_advance>=2
actions.generic+=/frostscythe,if=spell_targets.frostscythe>=3
actions.generic+=/obliterate,if=buff.killing_machine.react
actions.generic+=/obliterate
actions.generic+=/glacial_advance
actions.generic+=/horn_of_winter,if=!dot.hungering_rune_weapon.ticking
actions.generic+=/frost_strike
actions.generic+=/remorseless_winter,if=talent.frozen_pulse.enabled
actions.generic+=/empower_rune_weapon
actions.generic+=/hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking

actions.gs_ticking=frost_strike,if=buff.icy_talons.remains<1.5&talent.icy_talons.enabled
actions.gs_ticking+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.gs_ticking+=/howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
actions.gs_ticking+=/obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))
actions.gs_ticking+=/obliterate,if=rune>3|buff.killing_machine.react|buff.obliteration.up
actions.gs_ticking+=/frost_strike,if=runic_power>80|(buff.obliteration.up&!buff.killing_machine.react)
actions.gs_ticking+=/obliterate
actions.gs_ticking+=/horn_of_winter,if=runic_power<70&!dot.hungering_rune_weapon.ticking
actions.gs_ticking+=/glacial_advance
actions.gs_ticking+=/frost_strike
actions.gs_ticking+=/hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking
actions.gs_ticking+=/empower_rune_weapon

head=perseverance_of_the_ebon_martyr,id=132459,bonus_id=1811/3458
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806/1502,enchant=mark_of_the_hidden_satyr
shoulders=greystone_pauldrons,id=139098,bonus_id=3432/1808/1517/3337,gems=150haste
back=evergreen_vinewrap_drape,id=139248,bonus_id=1805/1487,enchant=150str
chest=horror_inscribed_chestguard,id=138216,bonus_id=1805/1497/3336
wrists=wristclamps_of_mad_dreams,id=139235,bonus_id=1805/1487
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1487
waist=eontempered_waistplate,id=139228,bonus_id=1805/1487
legs=tassets_of_perpetual_despair,id=142127,bonus_id=3453/1492/3337
feet=trampling_warboots,id=139234,bonus_id=1806/1808/1502,gems=150haste
finger1=terestians_signet_ring,id=142172,bonus_id=3453/1487/3337,enchant=200haste
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1492/3336,enchant=200haste
trinket1=ursocs_rending_paw,id=139328,bonus_id=1805/1492/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=142515/139251/139250/0,relic_id=3468:1497:3336/1806:1507:3336/1805:1487/0,enchant=rune_of_razorice
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=876.31
# gear_strength=16053
# gear_stamina=25868
# gear_crit_rating=7701
# gear_haste_rating=10181
# gear_mastery_rating=5099
# gear_versatility_rating=847
# gear_armor=4295

Ethila

Ethila : 416699 dps

  • Race: Human
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
416698.8 416698.8 278.5 / 0.067% 56155.2 / 13.5% 69166.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.0 6.0 Runic Power 23.10% 41.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ethila/advanced
Talents
  • 15: Icy Talons (Frost Death Knight)
  • 30: Frozen Pulse (Frost Death Knight)
  • 45: Icecap (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: Permafrost (Frost Death Knight)
  • 90: Frostscythe (Frost Death Knight)
  • 100: Obliteration (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • mining: 800
  • jewelcrafting: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ethila 416699
auto_attack_mh 19336 4.6% 200.7 1.50sec 28959 19359 Direct 200.7 25566 51136 28959 32.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.66 200.66 0.00 0.00 1.4959 0.0000 5810805.85 8542435.01 31.98 19358.90 19358.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.86 48.77% 25565.69 22215 28433 25569.07 24644 26469 2501775 3677847 31.98
crit 64.71 32.25% 51136.34 44430 56866 51143.06 48971 53132 3309030 4864588 31.98
miss 38.09 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9689 2.3% 200.7 1.50sec 14511 9701 Direct 200.7 12807 25615 14511 32.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.66 200.66 0.00 0.00 1.4959 0.0000 2911803.33 4280626.71 31.98 9700.77 9700.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.82 48.75% 12807.25 11108 14217 12809.07 12348 13256 1252824 1841770 31.98
crit 64.77 32.28% 25615.18 22215 28433 25618.86 24304 26771 1658979 2438857 31.98
miss 38.07 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Crystalline Swords 20507 4.9% 61.5 9.67sec 100237 0 Direct 58.4 79827 159787 105655 32.3% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.53 58.37 0.00 0.00 0.0000 0.0000 6167376.83 6167376.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.52 67.70% 79827.33 57550 109070 79836.92 68663 89304 3154558 3154558 0.00
crit 18.85 32.30% 159786.52 115101 218140 159813.85 128830 197336 3012819 3012819 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Frost Fever 15857 (24522) 3.8% (5.9%) 32.5 9.40sec 227118 0 Periodic 99.9 36084 72154 47748 32.3% 0.0% 99.2%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.47 0.00 99.88 99.88 0.0000 2.9886 4769103.43 4769103.43 0.00 24705.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.6 67.66% 36084.34 9 49990 36096.10 32991 39560 2438638 2438638 0.00
crit 32.3 32.34% 72154.38 70 99981 72189.54 62188 83911 2330465 2330465 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Hypothermia 8664 2.1% 10.0 27.10sec 261825 0 Direct 10.0 197643 395280 261830 32.5% 0.0%  

Stats details: hypothermia

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.95 9.95 0.00 0.00 0.0000 0.0000 2605651.68 2605651.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 67.52% 197643.05 143876 272675 197442.27 0 272675 1328155 1328155 0.00
crit 3.23 32.48% 395280.40 287752 545350 378534.76 0 545350 1277497 1277497 0.00
 
 

Action details: hypothermia

Static Values
  • id:228322
  • school:frost
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228322
  • name:Hypothermia
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage.
 
Frost Strike 0 (91792) 0.0% (22.0%) 72.4 4.15sec 380627 318896

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.38 0.00 0.00 0.00 1.1936 0.0000 0.00 0.00 0.00 318896.40 318896.40
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.icy_talons.enabled&buff.icy_talons.remains<1.5&cooldown.breath_of_sindragosa.remains>6
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 53983 12.9% 72.4 4.15sec 223859 0 Direct 72.4 169186 338281 223860 32.3% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.38 72.38 0.00 0.00 0.0000 0.0000 16204031.66 16204031.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.98 67.67% 169186.27 127761 223513 169241.02 153842 182961 8286930 8286930 0.00
crit 23.40 32.33% 338281.46 255522 447026 338331.31 280950 391593 7917102 7917102 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
    Frost Strike Off-Hand 37809 9.1% 72.4 4.15sec 156768 0 Direct 72.4 118461 237022 156772 32.3% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.38 72.38 0.00 0.00 0.0000 0.0000 11347660.60 11347660.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.00 67.69% 118460.53 89436 156463 118501.05 108241 128550 5804227 5804227 0.00
crit 23.39 32.31% 237021.92 178872 312927 237104.09 205791 274077 5543433 5543433 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
Frozen Pulse 48127 11.6% 253.1 1.97sec 57221 0 Direct 253.1 43263 86555 57221 32.2% 0.0%  

Stats details: frozen_pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 253.12 253.12 0.00 0.00 0.0000 0.0000 14484090.35 14484090.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.51 67.76% 43263.06 31654 59991 43275.31 40093 46476 7420056 7420056 0.00
crit 81.61 32.24% 86555.49 63309 119982 86576.72 77657 96455 7064034 7064034 0.00
 
 

Action details: frozen_pulse

Static Values
  • id:195750
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195750
  • name:Frozen Pulse
  • school:frost
  • tooltip:
  • description:{$@spelldesc194909=While you have fewer than $m2 full $LRune:Runes;, your auto attacks radiate intense cold, inflicting {$195750s1=1} Frost damage on all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.660000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Howling Blast 42034 10.1% 32.5 9.40sec 388492 326874 Direct 32.5 293632 587967 388497 32.2% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.47 32.47 0.00 0.00 1.1885 0.0000 12614738.71 12614738.71 0.00 326874.45 326874.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.01 67.77% 293632.48 55392 419920 293279.91 225201 353813 6461511 6461511 0.00
crit 10.47 32.23% 587967.40 110785 839839 587178.09 258158 773589 6153228 6153228 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Mark of the Hidden Satyr 7726 1.9% 18.0 16.53sec 128910 0 Direct 18.0 97483 194928 128910 32.3% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.01 18.01 0.00 0.00 0.0000 0.0000 2321641.57 2321641.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.20 67.75% 97483.44 80955 111718 97480.44 85543 111718 1189460 1189460 0.00
crit 5.81 32.25% 194927.87 161910 223437 194319.32 0 223437 1132181 1132181 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Obliterate 0 (93706) 0.0% (22.5%) 77.1 3.90sec 364490 307472

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.15 0.00 0.00 0.00 1.1854 0.0000 0.00 0.00 0.00 307472.12 307472.12
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.rime.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 55121 13.2% 77.1 3.90sec 214397 0 Direct 77.1 109982 275274 214400 63.2% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.15 77.15 0.00 0.00 0.0000 0.0000 16540010.81 24315382.61 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.41 36.83% 109981.53 95564 121737 109995.35 103715 116473 3124921 4593930 31.98
crit 48.73 63.17% 275274.14 236999 301909 275328.70 261514 287541 13415090 19721452 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.56
 
    Obliterate Off-Hand 38585 9.3% 77.1 3.90sec 150094 0 Direct 77.1 76971 192725 150097 63.2% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.15 77.15 0.00 0.00 0.0000 0.0000 11579237.06 17022575.29 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.41 36.83% 76970.51 66897 85219 76980.31 71912 81471 2186924 3214986 31.98
crit 48.73 63.17% 192725.21 165906 211342 192758.88 184376 201120 9392313 13807589 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.56
 
Pepper Breath 4053 1.0% 14.5 20.71sec 84256 0 Periodic 71.8 16964 0 16964 0.0% 0.0% 6.0%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.46 0.00 71.89 71.82 0.0000 0.2496 1218302.10 1218302.10 0.00 67898.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.8 100.00% 16963.53 68 16990 16965.00 16460 16990 1218302 1218302 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Potion of the Old War 14106 3.3% 24.7 3.84sec 169072 0 Direct 24.7 127706 255411 169075 32.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.68 24.68 0.00 0.00 0.0000 0.0000 4172831.23 6134457.16 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.69 67.61% 127705.72 127706 127706 127705.72 127706 127706 2130919 3132653 31.98
crit 7.99 32.39% 255411.43 255411 255411 255385.89 0 255411 2041912 3001804 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Razorice 11087 2.7% 312.1 0.97sec 10668 0 Direct 312.1 8065 16131 10668 32.3% 0.0%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.08 312.08 0.00 0.00 0.0000 0.0000 3329201.16 3329201.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 211.38 67.73% 8065.16 6099 10720 8067.42 7687 8510 1704822 1704822 0.00
crit 100.70 32.27% 16130.91 12197 21439 16136.26 14739 17638 1624379 1624379 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Remorseless Winter 0 (10738) 0.0% (2.6%) 10.5 26.86sec 309341 251824

Stats details: remorseless_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.46 0.00 0.00 0.00 1.2285 0.0000 0.00 0.00 0.00 251824.06 251824.06
 
 

Action details: remorseless_winter

Static Values
  • id:196770
  • school:frost
  • resource:rune
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.gathering_storm.enabled
Spelldata
  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
 
    Remorseless Winter (_damage) 9589 2.3% 82.3 3.19sec 35096 0 Direct 82.3 26527 53022 35095 32.3% 0.0%  

Stats details: remorseless_winter_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.33 82.33 0.00 0.00 0.0000 0.0000 2889309.57 2889309.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.70 67.66% 26527.11 19855 37629 26522.79 21776 32783 1477635 1477635 0.00
crit 26.62 32.34% 53021.99 39710 75258 53021.43 42337 63552 1411674 1411674 0.00
 
 

Action details: remorseless_winter_damage

Static Values
  • id:196771
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.}
 
    Frozen Soul 1149 0.3% 10.1 26.89sec 34241 0 Direct 10.1 25861 51755 34238 32.4% 0.0%  

Stats details: frozen_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 10.12 0.00 0.00 0.0000 0.0000 346377.74 346377.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.84 67.64% 25861.33 19185 36359 25862.93 19185 34638 176957 176957 0.00
crit 3.27 32.36% 51755.23 38370 72718 50397.81 0 72718 169421 169421 0.00
 
 

Action details: frozen_soul

Static Values
  • id:204959
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204959
  • name:Frozen Soul
  • school:frost
  • tooltip:
  • description:{$@spelldesc189184=When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Flesh 9648 2.3% 41.5 7.24sec 69907 0 Periodic 121.8 18001 36043 23826 32.3% 0.0% 81.0%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.52 0.00 121.81 121.81 0.0000 2.0000 2902267.93 2902267.93 0.00 11913.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.5 67.71% 18000.89 13469 52611 17980.49 14116 23328 1484732 1484732 0.00
crit 39.3 32.29% 36042.98 26939 105223 35998.91 27947 47690 1417536 1417536 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Sindragosa's Fury 9627 2.4% 1.3 315.81sec 2227246 2142867 Direct 1.3 1686739 3373090 2227313 32.1% 0.0%  

Stats details: sindragosas_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.32 1.32 0.00 0.00 1.0395 0.0000 2950727.84 2950727.84 0.00 2142866.99 2142866.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.90 67.95% 1686739.36 1103058 1817834 1268729.26 0 1817834 1518392 1518392 0.00
crit 0.42 32.05% 3373089.81 2082636 3635667 1314612.98 0 3635667 1432336 1432336 0.00
 
 

Action details: sindragosas_fury

Static Values
  • id:190778
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
Spelldata
  • id:190778
  • name:Sindragosa's Fury
  • school:frost
  • tooltip:
  • description:Summons Sindragosa, who breathes frost on all enemies within {$s1=40} yd in front of you, dealing {$190780s1=0} Frost damage and slowing movement speed by {$190780s2=50}% for {$190780d=10 seconds}.
 
Simple Action Stats Execute Interval
Ethila
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 64.50sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
Empower Rune Weapon 3.0 100.13sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:198.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<20
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
Obliteration 3.6 91.28sec

Stats details: obliteration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: obliteration

Static Values
  • id:207256
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
Spelldata
  • id:207256
  • name:Obliteration
  • school:physical
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
 
Pillar of Frost 7.1 46.92sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rend Flesh (rending_flesh_trigger) 41.5 7.25sec

Stats details: rending_flesh_trigger

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rending_flesh_trigger

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:48757.61
  • base_dd_max:48757.61
 
Unholy Strength 21.7 13.90sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 21.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 16.29% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.8 0.0 72.5sec 72.5sec 9.16% 9.16% 0.0(0.0) 2.7

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2855.97

Stack Uptimes

  • cleansed_ancients_blessing_1:9.16%

Trigger Attempt Success

  • trigger_pct:95.66%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 72.7sec 72.7sec 9.09% 9.09% 0.0(0.0) 2.7

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2855.97

Stack Uptimes

  • cleansed_sisters_blessing_1:9.09%

Trigger Attempt Success

  • trigger_pct:95.71%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 73.5sec 73.5sec 9.07% 9.07% 0.0(0.0) 2.7

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2855.97

Stack Uptimes

  • cleansed_wisps_blessing_1:9.07%

Trigger Attempt Success

  • trigger_pct:95.72%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Frozen Pulse 60.8 0.0 4.9sec 4.9sec 79.04% 77.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_frozen_pulse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frozen_pulse_1:79.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194909
  • name:Frozen Pulse
  • tooltip:
  • description:While you have fewer than $m2 full $LRune:Runes;, your auto attacks radiate intense cold, inflicting {$195750s1=1} Frost damage on all nearby enemies.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Frozen Soul 10.4 0.0 27.0sec 27.0sec 27.27% 27.27% 0.0(0.0) 10.1

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_frozen_soul
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • frozen_soul_1:27.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:189184
  • name:Frozen Soul
  • tooltip:
  • description:When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icy Talons 11.3 61.1 27.4sec 4.1sec 92.65% 85.84% 44.3(44.3) 10.4

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • icy_talons_1:15.57%
  • icy_talons_2:12.62%
  • icy_talons_3:64.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$s1=10}%.
  • description:{$@spelldesc194878=Frost Strike also increases your melee attack speed by {$194879s1=10}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 35.5 5.7 8.5sec 7.3sec 27.35% 45.67% 5.7(5.7) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:27.35%

Trigger Attempt Success

  • trigger_pct:32.02%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Obliteration 3.6 0.0 91.3sec 91.3sec 9.61% 14.47% 0.0(0.0) 3.6

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:9.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207256
  • name:Obliteration
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:100.00%
Pillar of Frost 7.1 0.0 45.7sec 46.9sec 45.70% 45.10% 0.0(0.0) 6.6

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:45.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 65.1sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Remorseless Winter 10.5 0.0 27.0sec 27.0sec 27.37% 27.37% 82.3(82.3) 10.2

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • remorseless_winter_1:27.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 31.2 3.5 9.6sec 8.6sec 22.77% 95.24% 3.5(3.5) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:22.77%

Trigger Attempt Success

  • trigger_pct:45.00%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 8.8 13.0 35.7sec 13.9sec 69.85% 68.64% 13.0(13.0) 8.1

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:69.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Killing Machine: Obliterate 35.2 8.5sec
Rune ready 147.4 2.8sec

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=81818)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.3501.451 / 0.9703.77911.078
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
4.6016.38011.862 / 10.66121.24737.499

Resources

Resource Usage Type Count Total Average RPE APR
Ethila
frost_strike Runic Power 72.4 1809.6 25.0 25.0 15225.2
howling_blast Rune 32.5 1.5 0.0 0.0 8496714.7
obliterate Rune 77.1 140.8 1.8 1.8 199780.0
remorseless_winter Rune 10.5 10.5 1.0 1.0 309333.9
Resource Gains Type Count Total Average Overflow
remorseless_winter Runic Power 10.46 104.60 (5.72%) 10.00 0.00 0.00%
obliterate Runic Power 77.15 1542.90 (84.36%) 20.00 0.02 0.00%
Frost Fever Runic Power 17.88 89.37 (4.89%) 5.00 0.01 0.01%
Rune Regeneration Rune 103.60 103.60 (70.28%) 1.00 0.00 0.00%
Runic Empowerment Rune 27.10 27.10 (18.38%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 16.71 16.71 (11.34%) 1.00 0.00 0.00%
Over-Powered Runic Power 7.72 77.15 (4.22%) 10.00 0.02 0.03%
Howling Blast Runic Power 1.48 14.85 (0.81%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 6.08 6.02
Rune 0.49 0.51
Combat End Resource Mean Min Max
Runic Power 19.79 0.00 85.00
Rune 0.75 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data Ethila Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Ethila Damage Per Second
Count 9999
Mean 416698.82
Minimum 370047.96
Maximum 475928.42
Spread ( max - min ) 105880.46
Range [ ( max - min ) / 2 * 100% ] 12.70%
Standard Deviation 14207.2515
5th Percentile 394164.33
95th Percentile 440894.27
( 95th Percentile - 5th Percentile ) 46729.94
Mean Distribution
Standard Deviation 142.0796
95.00% Confidence Intervall ( 416420.35 - 416977.30 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4466
0.1 Scale Factor Error with Delta=300 1723074
0.05 Scale Factor Error with Delta=300 6892295
0.01 Scale Factor Error with Delta=300 172307352
Priority Target DPS
Sample Data Ethila Priority Target Damage Per Second
Count 9999
Mean 416698.82
Minimum 370047.96
Maximum 475928.42
Spread ( max - min ) 105880.46
Range [ ( max - min ) / 2 * 100% ] 12.70%
Standard Deviation 14207.2515
5th Percentile 394164.33
95th Percentile 440894.27
( 95th Percentile - 5th Percentile ) 46729.94
Mean Distribution
Standard Deviation 142.0796
95.00% Confidence Intervall ( 416420.35 - 416977.30 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4466
0.1 Scale Factor Error with Delta=300 1723074
0.05 Scale Factor Error with Delta=300 6892295
0.01 Scale Factor Error with Delta=300 172307352
DPS(e)
Sample Data Ethila Damage Per Second (Effective)
Count 9999
Mean 416698.82
Minimum 370047.96
Maximum 475928.42
Spread ( max - min ) 105880.46
Range [ ( max - min ) / 2 * 100% ] 12.70%
Damage
Sample Data Ethila Damage
Count 9999
Mean 125165169.44
Minimum 90216670.79
Maximum 159983626.34
Spread ( max - min ) 69766955.55
Range [ ( max - min ) / 2 * 100% ] 27.87%
DTPS
Sample Data Ethila Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ethila Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ethila Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ethila Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ethila Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ethila Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EthilaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ethila Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 7.07 pillar_of_frost
0.00 mind_freeze
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=buff.pillar_of_frost.up
0.00 berserking,if=buff.pillar_of_frost.up
7 1.00 potion,name=old_war,if=buff.pillar_of_frost.up
8 1.32 sindragosas_fury,if=buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
9 3.65 obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
A 0.00 call_action_list,name=generic,if=!talent.breath_of_sindragosa.enabled&!(talent.gathering_storm.enabled&buff.remorseless_winter.remains)
B 0.00 call_action_list,name=bos,if=talent.breath_of_sindragosa.enabled&!dot.breath_of_sindragosa.ticking
C 0.00 call_action_list,name=bos_ticking,if=talent.breath_of_sindragosa.enabled&dot.breath_of_sindragosa.ticking
D 0.00 call_action_list,name=gs_ticking,if=talent.gathering_storm.enabled&buff.remorseless_winter.remains&!talent.breath_of_sindragosa.enabled
actions.generic
# count action,conditions
E 31.87 frost_strike,if=!talent.shattering_strikes.enabled&(buff.icy_talons.remains<1.5&talent.icy_talons.enabled)
0.00 frost_strike,if=talent.shattering_strikes.enabled&debuff.razorice.stack=5
F 1.72 howling_blast,target_if=!dot.frost_fever.ticking
0.00 obliterate,if=equipped.132366&talent.runic_attenuation.enabled&set_bonus.tier19_2pc=1
0.00 remorseless_winter,if=(buff.rime.react&equipped.132459&!(buff.obliteration.up&spell_targets.howling_blast<2))|talent.gathering_storm.enabled
G 30.75 howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
H 0.06 frost_strike,if=runic_power.deficit<=10
I 8.55 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2&!(talent.frostscythe.enabled&buff.killing_machine.react&spell_targets.frostscythe>=2)
0.00 frostscythe,if=(buff.killing_machine.react&spell_targets.frostscythe>=2)
0.00 glacial_advance,if=spell_targets.glacial_advance>=2
0.00 frostscythe,if=spell_targets.frostscythe>=3
J 31.19 obliterate,if=buff.killing_machine.react
K 45.96 obliterate
0.00 glacial_advance
0.00 horn_of_winter,if=!dot.hungering_rune_weapon.ticking
L 31.90 frost_strike
M 10.46 remorseless_winter,if=talent.frozen_pulse.enabled
N 3.00 empower_rune_weapon
0.00 hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking

Sample Sequence

02456FJE8GJKEKGL9NKIJIJIJIJKLKGLLKLMNKKKELJLL6JEGKLMKEGKLK7EKKEMLJEKJEFL6MJEKEGJ9IJKIJIGJLKKGELMKGEJE6KGLKEJLMJEKEKKEFLMKE6JEKKEFL9JIJIJKIJGLKLKGLNJKKELML6JGLJLJKEGLJGKEGMLKGEJKLGKLKKGEL6MJEGKEGKL9KIJIJIJGLJKGE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre precombat 2 augmentation Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre precombat 4 potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 default 6 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, unholy_strength, potion_of_the_old_war
0:00.000 generic F howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:00.970 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:01.938 generic E frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:02.907 default 8 sindragosas_fury Fluffy_Pillow 5.0/100: 5% runic_power | 4.0/6: 67% rune bloodlust, icy_talons, killing_machine, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:03.876 generic G howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 4.0/6: 67% rune bloodlust, icy_talons, killing_machine, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:04.845 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 4.0/6: 67% rune bloodlust, icy_talons, killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:05.815 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune bloodlust, icy_talons, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:06.786 generic E frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune bloodlust, icy_talons, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:07.754 generic K obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(2), pillar_of_frost, unholy_strength, potion_of_the_old_war
0:08.724 generic G howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(2), pillar_of_frost, rime, unholy_strength, frozen_pulse, potion_of_the_old_war
0:09.694 generic L frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(2), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.665 default 9 obliteration Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.665 generic N empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, frozen_pulse, potion_of_the_old_war
0:10.665 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:11.636 generic I frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:12.605 generic J obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:13.576 generic I frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:14.544 generic J obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:15.512 generic I frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:16.481 generic J obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 5.0/6: 83% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:17.450 generic I frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:18.419 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:19.388 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, icy_talons(3), pillar_of_frost, unholy_strength, potion_of_the_old_war
0:20.356 generic L frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
0:21.326 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, potion_of_the_old_war
0:22.296 generic G howling_blast Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), rime, unholy_strength, frozen_pulse, potion_of_the_old_war
0:23.266 generic L frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse
0:24.178 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, cleansed_sisters_blessing
0:25.088 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, cleansed_sisters_blessing
0:25.999 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, cleansed_sisters_blessing
0:26.907 generic M remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, cleansed_sisters_blessing
0:27.817 generic N empower_rune_weapon Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, remorseless_winter, cleansed_sisters_blessing
0:27.817 generic K obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 6.0/6: 100% rune bloodlust, icy_talons(3), unholy_strength, remorseless_winter, cleansed_sisters_blessing
0:28.727 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 4.0/6: 67% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter, cleansed_sisters_blessing
0:29.639 generic K obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), unholy_strength, frozen_soul, remorseless_winter, cleansed_sisters_blessing
0:30.550 generic E frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, cleansed_sisters_blessing
0:31.459 generic L frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, cleansed_sisters_blessing
0:32.367 Waiting     1.600 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, cleansed_sisters_blessing
0:33.967 generic J obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
0:34.936 generic L frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), unholy_strength, frozen_pulse, frozen_soul
0:35.905 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul
0:36.875 Waiting     2.900 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_pulse
0:39.775 default 6 pillar_of_frost Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune bloodlust, icy_talons(3), killing_machine, unholy_strength, frozen_pulse
0:40.000 Waiting     0.500 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
0:40.500 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength
0:41.761 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, rime, unholy_strength
0:43.020 generic G howling_blast Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, rime, unholy_strength
0:44.279 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
0:45.538 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
0:46.795 generic M remorseless_winter Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
0:48.168 Waiting     0.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
0:48.868 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
0:50.126 generic E frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse, frozen_soul, remorseless_winter
0:51.385 generic G howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, rime, frozen_soul, remorseless_winter
0:52.645 generic K obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, frozen_soul, remorseless_winter
0:53.905 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
0:55.165 Waiting     2.100 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse, frozen_soul
0:57.265 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune icy_talons(3), pillar_of_frost
0:58.525 default 7 potion Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost
0:58.525 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, potion_of_the_old_war
0:59.785 generic K obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, potion_of_the_old_war
1:01.044 Waiting     4.500 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse, potion_of_the_old_war
1:05.544 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune potion_of_the_old_war
1:06.804 generic E frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune frozen_pulse, potion_of_the_old_war
1:08.063 generic M remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune icy_talons, frozen_pulse, potion_of_the_old_war
1:09.322 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons, frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:10.581 Waiting     3.400 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(2), frozen_pulse, frozen_soul, remorseless_winter, potion_of_the_old_war
1:13.981 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune icy_talons(2), killing_machine, unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
1:15.242 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(2), unholy_strength, frozen_soul, remorseless_winter, potion_of_the_old_war
1:16.501 generic K obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength, frozen_soul, potion_of_the_old_war
1:17.760 Waiting     4.600 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse, potion_of_the_old_war
1:22.360 generic J obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, potion_of_the_old_war
1:23.619 generic E frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune rime, unholy_strength, frozen_pulse
1:24.879 generic F howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons, rime, unholy_strength, frozen_pulse
1:26.140 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons, killing_machine, unholy_strength, frozen_pulse
1:27.397 Waiting     0.400 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, frozen_pulse
1:27.797 default 6 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, frozen_pulse
1:28.000 generic M remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, pillar_of_frost, frozen_pulse
1:29.324 Waiting     1.400 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune icy_talons(2), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
1:30.724 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(2), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
1:31.984 generic E frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune icy_talons(2), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, cleansed_wisps_blessing
1:33.243 Waiting     5.800 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter, cleansed_wisps_blessing
1:39.043 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength, cleansed_wisps_blessing
1:40.228 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength, cleansed_sisters_blessing, cleansed_wisps_blessing
1:41.411 generic G howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 3.0/6: 50% rune icy_talons, killing_machine, pillar_of_frost, rime, unholy_strength, cleansed_sisters_blessing, cleansed_wisps_blessing
1:42.594 generic J obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 3.0/6: 50% rune icy_talons, killing_machine, pillar_of_frost, unholy_strength, cleansed_sisters_blessing
1:43.777 default 9 obliteration Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons, pillar_of_frost, frozen_pulse, cleansed_sisters_blessing
1:43.777 generic I frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons, obliteration, pillar_of_frost, frozen_pulse, cleansed_sisters_blessing
1:44.958 generic J obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, obliteration, pillar_of_frost, frozen_pulse, cleansed_sisters_blessing, cleansed_wisps_blessing
1:46.140 Waiting     0.800 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons(2), obliteration, pillar_of_frost, rime, frozen_pulse, cleansed_sisters_blessing, cleansed_wisps_blessing
1:46.940 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(2), obliteration, pillar_of_frost, rime, cleansed_sisters_blessing, cleansed_wisps_blessing
1:48.122 generic I frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune icy_talons(2), obliteration, rime, cleansed_sisters_blessing, cleansed_wisps_blessing
1:49.320 generic J obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, obliteration, rime, cleansed_wisps_blessing
1:50.580 generic I frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, rime, cleansed_wisps_blessing
1:51.841 generic G howling_blast Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, rime, cleansed_wisps_blessing
1:53.102 generic J obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, cleansed_wisps_blessing
1:54.360 generic L frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
1:55.620 generic K obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 3.0/6: 50% rune icy_talons(3)
1:56.880 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune icy_talons(3)
1:58.139 generic G howling_blast Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune icy_talons(3), rime, frozen_pulse
1:59.399 generic E frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse
2:00.660 generic L frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse
2:01.920 generic M remorseless_winter Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune icy_talons(3), frozen_pulse
2:03.178 Waiting     0.300 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons(3), frozen_pulse, frozen_soul, remorseless_winter
2:03.478 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), frozen_soul, remorseless_winter
2:04.738 generic G howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, rime, frozen_pulse, frozen_soul, remorseless_winter
2:05.999 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
2:07.258 Waiting     4.600 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
2:11.858 generic J obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, unholy_strength
2:13.118 generic E frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune unholy_strength
2:14.377 default 6 pillar_of_frost Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons, unholy_strength
2:14.377 generic K obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons, pillar_of_frost, unholy_strength
2:15.638 generic G howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons, pillar_of_frost, rime, unholy_strength, frozen_pulse
2:16.897 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse
2:18.157 Waiting     2.100 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(2), pillar_of_frost, unholy_strength, frozen_pulse
2:20.257 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune icy_talons(2), killing_machine, pillar_of_frost, unholy_strength
2:21.515 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(2), pillar_of_frost, unholy_strength
2:22.773 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength
2:24.033 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse
2:25.291 generic M remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
2:26.552 Waiting     2.100 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:28.652 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
2:29.910 generic E frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:31.169 Waiting     5.800 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
2:36.969 generic K obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune unholy_strength
2:38.229 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune unholy_strength
2:39.490 generic K obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons, killing_machine, unholy_strength
2:40.750 Waiting     4.600 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons, unholy_strength, frozen_pulse
2:45.350 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
2:46.609 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune frozen_pulse
2:47.868 generic F howling_blast Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons, frozen_pulse
2:49.127 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons, frozen_pulse
2:50.386 generic M remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(2), frozen_pulse
2:51.646 Waiting     2.100 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune icy_talons(2), frozen_pulse, frozen_soul, remorseless_winter
2:53.746 generic K obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(2), frozen_soul, remorseless_winter
2:55.005 generic E frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
2:56.264 Waiting     4.900 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse, frozen_soul, remorseless_winter
3:01.164 default 6 pillar_of_frost Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, frozen_pulse
3:01.377 Waiting     0.700 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, frozen_pulse
3:02.077 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, unholy_strength
3:03.336 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:04.594 generic K obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons, pillar_of_frost, unholy_strength
3:05.851 Waiting     4.600 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse
3:10.451 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:11.711 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
3:12.969 generic F howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons, killing_machine, pillar_of_frost, unholy_strength
3:14.229 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune icy_talons, killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
3:15.488 default 9 obliteration Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse
3:15.488 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, obliteration, pillar_of_frost, unholy_strength, frozen_pulse
3:16.747 generic I frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(2), obliteration, pillar_of_frost, unholy_strength, frozen_pulse
3:18.007 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, frozen_pulse
3:19.266 generic I frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, pillar_of_frost
3:20.525 generic J obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 4.0/6: 67% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, unholy_strength
3:21.785 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune icy_talons(3), obliteration, unholy_strength
3:23.045 generic I frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, unholy_strength
3:24.306 generic J obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength
3:25.564 generic G howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:26.822 generic L frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:28.081 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:29.339 generic L frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:30.600 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:31.862 generic G howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), rime, unholy_strength, frozen_pulse
3:33.121 generic L frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
3:34.379 generic N empower_rune_weapon Fluffy_Pillow 10.0/100: 10% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse
3:34.379 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 6.0/6: 100% rune icy_talons(3), killing_machine, unholy_strength
3:35.637 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 4.0/6: 67% rune icy_talons(3), unholy_strength
3:36.896 generic K obliterate Fluffy_Pillow 50.0/100: 50% runic_power | 2.0/6: 33% rune icy_talons(3), unholy_strength
3:38.156 generic E frost_strike Fluffy_Pillow 70.0/100: 70% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:39.416 generic L frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune icy_talons(3), unholy_strength, frozen_pulse
3:40.677 generic M remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse
3:41.938 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:43.197 default 6 pillar_of_frost Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, unholy_strength, frozen_soul, remorseless_winter
3:43.197 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
3:44.456 generic G howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:45.713 generic L frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
3:46.973 generic J obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
3:48.232 generic L frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, frozen_soul, remorseless_winter
3:49.491 Waiting     1.700 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, frozen_soul, cleansed_ancients_blessing
3:51.191 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, pillar_of_frost, cleansed_ancients_blessing
3:52.452 generic K obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, cleansed_ancients_blessing
3:53.712 generic E frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse, cleansed_ancients_blessing
3:54.971 generic G howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, frozen_pulse, cleansed_ancients_blessing
3:56.230 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, frozen_pulse, cleansed_ancients_blessing
3:57.488 Waiting     2.000 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse, cleansed_ancients_blessing
3:59.488 generic J obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, pillar_of_frost
4:00.746 generic G howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, rime, unholy_strength
4:02.006 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), pillar_of_frost, unholy_strength
4:03.265 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune rime, unholy_strength, frozen_pulse
4:04.523 generic G howling_blast Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons, rime, unholy_strength, frozen_pulse
4:05.781 generic M remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons, unholy_strength, frozen_pulse
4:07.041 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune icy_talons, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:08.300 generic K obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune icy_talons(2), unholy_strength, frozen_soul, remorseless_winter
4:09.559 generic G howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune icy_talons(2), rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:10.819 Waiting     5.200 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune icy_talons(2), killing_machine, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:16.019 generic E frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune killing_machine, frozen_pulse
4:17.278 generic J obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 4.0/6: 67% rune icy_talons, killing_machine
4:18.537 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune icy_talons
4:19.796 generic L frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune icy_talons, rime, frozen_pulse
4:21.056 generic G howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(2), rime
4:22.316 generic K obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(2)
4:23.576 generic L frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune icy_talons(2), frozen_pulse
4:24.836 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune icy_talons(3)
4:26.095 generic K obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune icy_talons(3)
4:27.353 generic G howling_blast Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, rime, frozen_pulse
4:28.614 generic E frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse
4:29.872 generic L frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, frozen_pulse
4:31.131 default 6 pillar_of_frost Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, frozen_pulse
4:31.131 generic M remorseless_winter Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, pillar_of_frost, frozen_pulse
4:32.390 Waiting     1.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:34.090 generic J obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, pillar_of_frost, unholy_strength, frozen_soul, remorseless_winter
4:35.350 generic E frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:36.611 generic G howling_blast Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, rime, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:37.873 Waiting     3.500 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(3), pillar_of_frost, unholy_strength, frozen_pulse, frozen_soul, remorseless_winter
4:41.373 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
4:42.633 generic E frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength
4:43.893 generic G howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons, pillar_of_frost, rime, unholy_strength
4:45.154 generic K obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune icy_talons, pillar_of_frost, unholy_strength
4:46.411 generic L frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune icy_talons, pillar_of_frost, unholy_strength, frozen_pulse
4:47.671 default 9 obliteration Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(2), pillar_of_frost, frozen_pulse
4:47.671 generic K obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune icy_talons(2), obliteration, pillar_of_frost, frozen_pulse
4:48.931 generic I frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune icy_talons(2), obliteration, pillar_of_frost, frozen_pulse
4:50.191 generic J obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, obliteration, pillar_of_frost, frozen_pulse
4:51.449 generic I frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune icy_talons(3), obliteration, rime, unholy_strength, cleansed_wisps_blessing
4:52.708 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength, cleansed_wisps_blessing
4:53.969 generic I frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), obliteration, rime, unholy_strength, frozen_pulse, cleansed_wisps_blessing
4:55.229 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune icy_talons(3), killing_machine, obliteration, rime, unholy_strength, cleansed_wisps_blessing
4:56.488 generic G howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse, cleansed_wisps_blessing
4:57.749 generic L frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune icy_talons(3), killing_machine, unholy_strength, frozen_pulse, cleansed_wisps_blessing
4:59.009 generic J obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune icy_talons(3), killing_machine, unholy_strength, cleansed_wisps_blessing
5:00.269 generic K obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 3.0/6: 50% rune icy_talons(3), unholy_strength, cleansed_wisps_blessing
5:01.529 generic G howling_blast Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune icy_talons(3), rime, unholy_strength, frozen_pulse
5:02.789 generic E frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune icy_talons(3), unholy_strength, frozen_pulse

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 29305 27599 16054 (10750)
Agility 7857 7532 0
Stamina 44760 44760 25943
Intellect 4327 4002 0
Spirit 0 0 0
Health 2685600 2685600 0
Runic Power 100 100 0
Rune 6 6 0
Crit 31.63% 31.63% 10653
Haste 19.50% 19.50% 7314
Swing Speed 33.84% 33.84% 7314
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29305 27599 0
Mastery 27.51% 27.51% 4134
Armor 4694 4694 4267
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 880.00
Local Head Crown of Fallen Kings
ilevel: 870, stats: { 580 Armor, +2461 Sta, +1641 StrInt, +1055 Crit, +422 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1519 Sta, +1707 Crit, +891 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Midnight Herald's Pauldrons
ilevel: 865, stats: { 529 Armor, +1761 Sta, +1174 StrInt, +730 Haste, +357 Crit }
Local Chest Inferno Breastplate
ilevel: 880, stats: { 729 Armor, +1801 StrInt, +2702 Sta, +931 Haste, +602 Crit }
Local Waist Waistplate of Nameless Horror
ilevel: 865, stats: { 397 Armor, +1761 Sta, +1174 StrInt, +660 Haste, +427 Crit, +466 Avoidance }
Local Legs Felsworn Legplates
ilevel: 855, stats: { 604 Armor, +1427 StrInt, +2140 Sta, +837 Crit, +559 Haste }
Local Feet Lead-Soled Seabed Striders
ilevel: 875, stats: { 496 Armor, +1933 Sta, +1289 StrInt, +782 Haste, +346 Crit }
Local Wrists Toravon's Whiteout Bindings
ilevel: 910, stats: { 341 Armor, +2010 Sta, +1340 Str, +551 Haste, +413 Mastery }
Local Hands The Soulbinder's Gauntlets
ilevel: 870, stats: { 446 Armor, +1231 StrInt, +1846 Sta, +554 Haste, +554 Mastery }
Local Finger1 Seal of Necrofantasia
ilevel: 910, stats: { +2010 Sta, +2004 Crit, +1114 Mastery }, gems: { +200 Str }, enchant: { +200 Haste }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 870, stats: { +1385 Sta, +1677 Crit, +768 Haste }, enchant: { +200 Haste }
Local Trinket1 Nature's Call
ilevel: 865, stats: { +345 Mastery, +345 Haste, +345 Crit }
Local Trinket2 Ursoc's Rending Paw
ilevel: 875, stats: { +1634 Str }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +1013 StrAgiInt, +1519 Sta, +505 Mastery, +357 Crit }, enchant: { +200 Str }
Local Main Hand Blades of the Fallen Prince
ilevel: 904, weapon: { 5449 - 10122, 2.6 }, stats: { +965 Str, +1448 Sta, +365 Crit, +350 Mastery }, enchant: rune_of_razorice, relics: { +52 ilevels, +53 ilevels, +49 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 904, weapon: { 5449 - 10122, 2.6 }, stats: { +965 Str, +1448 Sta, +365 Crit, +350 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Ethila"
origin="https://eu.api.battle.net/wow/character/hyjal/Ethila/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/179/115079091-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=jewelcrafting=800/mining=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!1102100
artifact=12:0:0:0:0:108:1:109:3:110:3:111:3:113:3:114:3:115:3:117:3:119:1:120:1:122:1:123:1:124:1:1090:3:1091:1:1092:1:1332:1:1360:12
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/pillar_of_frost
actions+=/mind_freeze
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=buff.pillar_of_frost.up
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/potion,name=old_war,if=buff.pillar_of_frost.up
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up&(buff.unholy_strength.up|(buff.pillar_of_frost.remains<3&target.time_to_die<60))&debuff.razorice.stack==5&!buff.obliteration.up
actions+=/obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))&!talent.gathering_storm.enabled
actions+=/call_action_list,name=generic,if=!talent.breath_of_sindragosa.enabled&!(talent.gathering_storm.enabled&buff.remorseless_winter.remains)
actions+=/call_action_list,name=bos,if=talent.breath_of_sindragosa.enabled&!dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=bos_ticking,if=talent.breath_of_sindragosa.enabled&dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=gs_ticking,if=talent.gathering_storm.enabled&buff.remorseless_winter.remains&!talent.breath_of_sindragosa.enabled

actions.bos=frost_strike,if=talent.icy_talons.enabled&buff.icy_talons.remains<1.5&cooldown.breath_of_sindragosa.remains>6
actions.bos+=/remorseless_winter,if=talent.gathering_storm.enabled
actions.bos+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/breath_of_sindragosa,if=runic_power>=50
actions.bos+=/frost_strike,if=runic_power>=90&set_bonus.tier19_4pc
actions.bos+=/remorseless_winter,if=buff.rime.react&equipped.132459
actions.bos+=/howling_blast,if=buff.rime.react&(dot.remorseless_winter.ticking|cooldown.remorseless_winter.remains>1.5|!equipped.132459)
actions.bos+=/frost_strike,if=runic_power>=70
actions.bos+=/obliterate,if=!buff.rime.react
actions.bos+=/horn_of_winter,if=cooldown.breath_of_sindragosa.remains>15&runic_power<=70
actions.bos+=/frost_strike,if=cooldown.breath_of_sindragosa.remains>15
actions.bos+=/remorseless_winter,if=cooldown.breath_of_sindragosa.remains>10

actions.bos_ticking=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos_ticking+=/remorseless_winter,if=((runic_power>=20&set_bonus.tier19_4pc)|runic_power>=30)&buff.rime.react&(equipped.132459|talent.gathering_storm.enabled)
actions.bos_ticking+=/howling_blast,if=((runic_power>=20&set_bonus.tier19_4pc)|runic_power>=30)&buff.rime.react
actions.bos_ticking+=/obliterate,if=runic_power<=75|rune>3
actions.bos_ticking+=/horn_of_winter,if=runic_power<70&!dot.hungering_rune_weapon.ticking
actions.bos_ticking+=/hungering_rune_weapon,if=runic_power<30&!dot.hungering_rune_weapon.ticking
actions.bos_ticking+=/empower_rune_weapon,if=runic_power<20
actions.bos_ticking+=/remorseless_winter,if=talent.gathering_storm.enabled|!set_bonus.tier19_4pc|runic_power<30

actions.generic=frost_strike,if=!talent.shattering_strikes.enabled&(buff.icy_talons.remains<1.5&talent.icy_talons.enabled)
actions.generic+=/frost_strike,if=talent.shattering_strikes.enabled&debuff.razorice.stack=5
actions.generic+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/obliterate,if=equipped.132366&talent.runic_attenuation.enabled&set_bonus.tier19_2pc=1
actions.generic+=/remorseless_winter,if=(buff.rime.react&equipped.132459&!(buff.obliteration.up&spell_targets.howling_blast<2))|talent.gathering_storm.enabled
actions.generic+=/howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
actions.generic+=/frost_strike,if=runic_power.deficit<=10
actions.generic+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.generic+=/remorseless_winter,if=spell_targets.remorseless_winter>=2&!(talent.frostscythe.enabled&buff.killing_machine.react&spell_targets.frostscythe>=2)
actions.generic+=/frostscythe,if=(buff.killing_machine.react&spell_targets.frostscythe>=2)
actions.generic+=/glacial_advance,if=spell_targets.glacial_advance>=2
actions.generic+=/frostscythe,if=spell_targets.frostscythe>=3
actions.generic+=/obliterate,if=buff.killing_machine.react
actions.generic+=/obliterate
actions.generic+=/glacial_advance
actions.generic+=/horn_of_winter,if=!dot.hungering_rune_weapon.ticking
actions.generic+=/frost_strike
actions.generic+=/remorseless_winter,if=talent.frozen_pulse.enabled
actions.generic+=/empower_rune_weapon
actions.generic+=/hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking

actions.gs_ticking=frost_strike,if=buff.icy_talons.remains<1.5&talent.icy_talons.enabled
actions.gs_ticking+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.gs_ticking+=/howling_blast,if=buff.rime.react&!(buff.obliteration.up&spell_targets.howling_blast<2)
actions.gs_ticking+=/obliteration,if=(!talent.frozen_pulse.enabled|(rune<2&runic_power<28))
actions.gs_ticking+=/obliterate,if=rune>3|buff.killing_machine.react|buff.obliteration.up
actions.gs_ticking+=/frost_strike,if=runic_power>80|(buff.obliteration.up&!buff.killing_machine.react)
actions.gs_ticking+=/obliterate
actions.gs_ticking+=/horn_of_winter,if=runic_power<70&!dot.hungering_rune_weapon.ticking
actions.gs_ticking+=/glacial_advance
actions.gs_ticking+=/frost_strike
actions.gs_ticking+=/hungering_rune_weapon,if=!dot.hungering_rune_weapon.ticking
actions.gs_ticking+=/empower_rune_weapon

head=crown_of_fallen_kings,id=133629,bonus_id=1726/1522/3337
neck=blackened_portalstone_necklace,id=139332,bonus_id=1805/1502/3337,enchant=mark_of_the_hidden_satyr
shoulders=midnight_heralds_pauldrons,id=139232,bonus_id=1805/1487
back=gossamerspun_greatcloak,id=138221,bonus_id=1806/1502,enchant=200str
chest=inferno_breastplate,id=134503,bonus_id=3416/1532/3337
wrists=toravons_whiteout_bindings,id=132458,bonus_id=1811/3458
hands=the_soulbinders_gauntlets,id=139996
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1805/40/1487
legs=felsworn_legplates,id=140009,bonus_id=3474/1517/3336
feet=leadsoled_seabed_striders,id=142426,bonus_id=3468/1492
finger1=seal_of_necrofantasia,id=137223,bonus_id=3459/3458,gems=200str,enchant=200haste
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1492/3336,enchant=200haste
trinket1=natures_call,id=139334,bonus_id=1805/1487
trinket2=ursocs_rending_paw,id=139328,bonus_id=1805/1497/3336
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=139250/139251/139259/0,relic_id=1806:1502/1805:1507:3337/1805:1492:3336/0,enchant=rune_of_razorice
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=879.88
# gear_strength=16054
# gear_stamina=25943
# gear_crit_rating=10444
# gear_haste_rating=7171
# gear_mastery_rating=4053
# gear_avoidance_rating=466
# gear_armor=4267

Nebriniel

Nebriniel : 396890 dps

  • Race: Night Elf
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
396890.1 396890.1 260.7 / 0.066% 50635.3 / 12.8% 48606.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.1 Astral Power 0.00% 51.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Nebriniel/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Restoration Affinity
  • 60: Typhoon
  • 75: Incarnation: Chosen of Elune
  • 90: Shooting Stars (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • alchemy: 780
  • inscription: 714

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Nebriniel 396890
Deadly Grace 15266 3.8% 28.9 7.77sec 156132 0 Direct 28.9 126674 253378 156134 23.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.93 28.93 0.00 0.00 0.0000 0.0000 4516211.81 4516211.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.20 76.75% 126673.96 96885 130795 126661.77 118926 130795 2812202 2812202 0.00
crit 6.73 23.25% 253378.06 193770 261589 253138.19 0 261589 1704009 1704009 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 22214 5.6% 7.1 43.66sec 938499 407826 Direct 6.4 852741 1706261 1049187 23.0%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.13 6.38 0.00 0.00 2.3014 0.0000 6689160.73 6689160.73 0.00 407825.92 407825.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.91 76.98% 852741.49 840469 1134633 853042.97 0 1134633 4184952 4184952 0.00
crit 1.47 23.02% 1706260.76 1680937 2269265 1380009.82 0 2269265 2504208 2504208 0.00
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and reduced damage to all other nearby enemies, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.720000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 12801 3.2% 7.5 42.77sec 515207 343833 Direct 7.4 420235 840470 517261 23.1%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.47 7.44 0.00 0.00 1.4985 0.0000 3846458.99 3846458.99 0.00 343832.93 343832.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.72 76.91% 420234.95 420235 420235 420234.95 420235 420235 2403312 2403312 0.00
crit 1.72 23.09% 840469.91 840470 840470 719093.92 0 840470 1443147 1443147 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.360000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 75378 19.0% 60.4 4.87sec 374158 254268 Direct 60.4 270549 541083 374159 38.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.40 60.40 0.00 0.00 1.4715 0.0000 22598327.24 22598327.24 0.00 254268.05 254268.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.27 61.70% 270549.38 245828 331868 270853.79 252998 290718 10082466 10082466 0.00
crit 23.13 38.30% 541082.99 491656 663736 541719.69 491656 616805 12515862 12515862 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.953600
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 7037 1.8% 19.4 15.50sec 109057 0 Direct 19.4 88511 176829 109057 23.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.36 19.36 0.00 0.00 0.0000 0.0000 2111268.09 2111268.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.86 76.74% 88511.34 81630 110201 88602.99 81630 103852 1314924 1314924 0.00
crit 4.50 23.26% 176829.28 163261 220402 175112.27 0 220402 796344 796344 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 31188 7.9% 1.0 0.00sec 9358577 10139303 Direct 1.0 68364 136729 84309 23.3%  
Periodic 202.8 37095 74164 45731 23.3% 99.7%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 202.80 202.80 0.9233 1.4795 9358577.02 9358577.02 0.00 31096.16 10139303.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.77 76.66% 68364.32 68364 68364 52406.49 0 68364 52406 52406 0.00
crit 0.23 23.34% 136728.64 136729 136729 31915.66 0 136729 31916 31916 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 155.6 76.70% 37094.85 34183 46147 37137.28 36039 38516 5770165 5770165 0.00
crit 47.2 23.30% 74163.81 68366 92294 74249.71 69695 80622 3504090 3504090 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s5487=true}[ Usable while in Bear Form.][]{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 6714 1.7% 6.8 41.95sec 295294 255232 Direct 7.8 210368 420705 258656 23.0%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 7.79 0.00 0.00 1.1570 0.0000 2014546.84 2014546.84 0.00 255232.08 255232.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.00 77.05% 210367.92 210118 283659 210368.71 210118 234632 1262419 1262419 0.00
crit 1.79 22.95% 420704.70 420236 567319 363810.50 0 567319 752128 752128 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.680000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shooting Stars 3956 1.0% 40.5 7.25sec 29378 0 Direct 35.7 27029 54108 33322 23.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.52 35.72 0.00 0.00 0.0000 0.0000 1190307.61 1190307.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.42 76.76% 27028.98 24693 33336 27062.77 24693 30635 741138 741138 0.00
crit 8.30 23.24% 54108.11 49386 66672 54144.27 0 66672 449170 449170 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a {$s1=10}% chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Solar Wrath 80562 20.3% 106.7 2.77sec 226746 227239 Direct 106.2 184927 369841 227871 23.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.71 106.18 0.00 0.00 0.9978 0.0000 24196438.56 24196438.56 0.00 227239.28 227239.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.52 76.78% 184927.30 118788 280455 185359.03 171900 209454 15076245 15076245 0.00
crit 24.66 23.22% 369841.01 237575 560911 370701.71 281731 476437 9120194 9120194 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.080000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starsurge 97053 (113516) 24.4% (28.6%) 61.2 4.87sec 555771 502679 Direct 61.0 337535 675408 476623 41.2%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.22 61.03 0.00 0.00 1.1056 0.0000 29087368.81 29087368.81 0.00 502678.85 502678.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.91 58.83% 337535.33 304435 410987 337951.56 314121 369293 12119128 12119128 0.00
crit 25.12 41.17% 675408.13 608870 821974 676228.18 617066 759296 16968240 16968240 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively.$?a231021[ You can accumulate up to {$164547u=1} of each Empowerment.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.680000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 16463 4.1% 20.2 14.53sec 244317 0 Direct 20.1 199036 398695 245435 23.2%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.11 0.00 0.00 0.0000 0.0000 4935946.60 4935946.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.44 76.76% 199036.50 179587 242443 199309.67 179587 242443 3072778 3072778 0.00
crit 4.67 23.24% 398695.49 359174 484885 395794.00 0 484885 1863169 1863169 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Sunfire 28257 7.1% 1.0 0.00sec 8479486 9196839 Direct 1.0 62149 124299 76651 23.3%  
Periodic 202.0 33750 67509 41592 23.2% 99.4%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 202.03 202.03 0.9222 1.4805 8479485.67 8479485.67 0.00 28262.22 9196839.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.77 76.66% 62149.38 62149 62149 47642.26 0 62149 47642 47642 0.00
crit 0.23 23.34% 124298.76 124299 124299 29014.23 0 124299 29014 29014 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 155.1 76.77% 33750.48 31075 41952 33789.97 32789 35091 5234731 5234731 0.00
crit 46.9 23.23% 67508.72 62151 83904 67587.46 63430 73027 3168098 3168098 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
Nebriniel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nebriniel
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nebriniel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nebriniel
  • harmful:false
  • if_expr:
 
Incarnation: Chosen of Elune (incarnation) 2.0 182.34sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: incarnation

Static Values
  • id:102560
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases the damage of all your spells by {$s1=35}% and causes your Lunar Strike and Solar Wrath to generate {$s4=50}% additional Astral Power. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 4.8 0.8 55.5sec 45.6sec 17.11% 17.11% 0.8(0.8) 4.7

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:5172.50

Stack Uptimes

  • acceleration_1:17.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 45.29% 0.0(0.0) 1.0

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 2.0 0.0 182.4sec 182.4sec 20.29% 20.29% 0.0(0.0) 2.0

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.35

Stack Uptimes

  • incarnation_chosen_of_elune_1:20.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases the damage of all your spells by {$s1=35}% and causes your Lunar Strike and Solar Wrath to generate {$s4=50}% additional Astral Power. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Lunar Empowerment 51.1 10.1 5.8sec 4.9sec 74.42% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • lunar_empowerment_1:61.62%
  • lunar_empowerment_2:12.35%
  • lunar_empowerment_3:0.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 186.9sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Solar Empowerment 57.8 3.4 5.2sec 4.9sec 42.70% 57.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • solar_empowerment_1:40.32%
  • solar_empowerment_2:2.37%
  • solar_empowerment_3:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Star Power 2.0 60.5 182.4sec 3.5sec 20.29% 24.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_star_power
  • max_stacks:50
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • star_power_1:1.20%
  • star_power_2:0.76%
  • star_power_3:0.73%
  • star_power_4:0.52%
  • star_power_5:0.85%
  • star_power_6:0.81%
  • star_power_7:0.53%
  • star_power_8:0.79%
  • star_power_9:0.69%
  • star_power_10:0.78%
  • star_power_11:0.52%
  • star_power_12:0.63%
  • star_power_13:0.88%
  • star_power_14:0.58%
  • star_power_15:0.52%
  • star_power_16:0.73%
  • star_power_17:0.75%
  • star_power_18:0.50%
  • star_power_19:0.57%
  • star_power_20:0.77%
  • star_power_21:0.64%
  • star_power_22:0.47%
  • star_power_23:0.64%
  • star_power_24:0.71%
  • star_power_25:0.54%
  • star_power_26:0.54%
  • star_power_27:0.41%
  • star_power_28:0.36%
  • star_power_29:0.30%
  • star_power_30:0.19%
  • star_power_31:0.25%
  • star_power_32:0.30%
  • star_power_33:0.26%
  • star_power_34:0.21%
  • star_power_35:0.24%
  • star_power_36:0.11%
  • star_power_37:0.01%
  • star_power_38:0.00%
  • star_power_39:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202942
  • name:Star Power
  • tooltip:Increases haste by ${$w1}.1%.
  • description:
  • max_stacks:50
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Nebriniel
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Nebriniel
starsurge Astral Power 61.2 2448.7 40.0 40.0 13894.4
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 7.82 78.22 (3.17%) 10.00 0.00 0.00%
half_moon Astral Power 7.47 149.31 (6.05%) 20.00 0.00 0.00%
full_moon Astral Power 7.13 285.10 (11.56%) 40.00 0.00 0.00%
moonfire Astral Power 1.00 3.00 (0.12%) 3.00 0.00 0.00%
shooting_stars Astral Power 40.52 162.06 (6.57%) 4.00 0.00 0.00%
sunfire Astral Power 1.00 3.00 (0.12%) 3.00 0.00 0.00%
solar_wrath Astral Power 106.71 957.31 (38.81%) 8.97 0.00 0.00%
lunar_strike Astral Power 60.40 828.88 (33.60%) 13.72 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.20 8.14
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 18.88 0.00 56.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data Nebriniel Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Nebriniel Damage Per Second
Count 9999
Mean 396890.12
Minimum 360608.26
Maximum 451144.22
Spread ( max - min ) 90535.96
Range [ ( max - min ) / 2 * 100% ] 11.41%
Standard Deviation 13299.6694
5th Percentile 376438.85
95th Percentile 420032.19
( 95th Percentile - 5th Percentile ) 43593.34
Mean Distribution
Standard Deviation 133.0033
95.00% Confidence Intervall ( 396629.44 - 397150.80 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4314
0.1 Scale Factor Error with Delta=300 1509960
0.05 Scale Factor Error with Delta=300 6039839
0.01 Scale Factor Error with Delta=300 150995971
Priority Target DPS
Sample Data Nebriniel Priority Target Damage Per Second
Count 9999
Mean 396890.12
Minimum 360608.26
Maximum 451144.22
Spread ( max - min ) 90535.96
Range [ ( max - min ) / 2 * 100% ] 11.41%
Standard Deviation 13299.6694
5th Percentile 376438.85
95th Percentile 420032.19
( 95th Percentile - 5th Percentile ) 43593.34
Mean Distribution
Standard Deviation 133.0033
95.00% Confidence Intervall ( 396629.44 - 397150.80 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4314
0.1 Scale Factor Error with Delta=300 1509960
0.05 Scale Factor Error with Delta=300 6039839
0.01 Scale Factor Error with Delta=300 150995971
DPS(e)
Sample Data Nebriniel Damage Per Second (Effective)
Count 9999
Mean 396890.12
Minimum 360608.26
Maximum 451144.22
Spread ( max - min ) 90535.96
Range [ ( max - min ) / 2 * 100% ] 11.41%
Damage
Sample Data Nebriniel Damage
Count 9999
Mean 119024097.99
Minimum 90929746.05
Maximum 149909882.04
Spread ( max - min ) 58980136.00
Range [ ( max - min ) / 2 * 100% ] 24.78%
DTPS
Sample Data Nebriniel Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Nebriniel Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Nebriniel Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Nebriniel Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Nebriniel Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Nebriniel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data NebrinielTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Nebriniel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher&active_enemies<=2
B 0.16 new_moon,if=(charges=2&recharge_time<5)|charges=3
0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
C 0.62 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
0.00 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
D 1.00 moonfire,cycle_targets=1,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
E 1.00 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
F 2.01 incarnation,if=astral_power>=40
0.00 celestial_alignment,if=astral_power>=40
0.00 starfall,if=buff.oneths_overconfidence.up
G 0.01 solar_wrath,if=buff.solar_empowerment.stack=3
H 0.51 lunar_strike,if=buff.lunar_empowerment.stack=3
I 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
J 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
0.00 starfall,if=((active_enemies>=2&talent.stellar_drift.enabled)|active_enemies>=3)
K 19.00 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
L 18.64 solar_wrath,if=buff.solar_empowerment.up
M 18.06 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
N 8.04 solar_wrath
actions.single_target
# count action,conditions
O 6.68 new_moon,if=astral_power<=90
P 7.50 half_moon,if=astral_power<=80
Q 6.56 full_moon,if=astral_power<=60
0.00 starfall,if=((active_enemies>=2&talent.stellar_drift.enabled)|active_enemies>=3)
R 42.22 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
S 42.30 solar_wrath,if=buff.solar_empowerment.up
T 42.12 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
U 38.09 solar_wrath

Sample Sequence

012367DEPQFKLKLMKLMMKLMKLMNKLMNKLMKLMNKLMNKLMKLOPTRSTUURSQRSTTRSTUUROSTRSTUURSTUPRSTURSTUURSQRSTRSTTURSOTUURSTUURSTPRSTUURSTUUQRSRSTTRSTUORSTUUURSTURPSTRSTURSTUUQRRSSTTF8KLMNKLMKLMNKLMNKLMNKLMKLMNKLMOPRSQRSTRSTTRSTOURSTUURSTUUPRSTRSTUUURSTQRSTRSTURSTOURSTUURSTUPRS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Nebriniel 0.0/100: 0% astral_power | 704000.0/704000: 100% mana
Pre precombat 1 food Nebriniel 0.0/100: 0% astral_power | 704000.0/704000: 100% mana
Pre precombat 2 augmentation Nebriniel 0.0/100: 0% astral_power | 704000.0/704000: 100% mana
Pre precombat 3 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana
Pre precombat 6 potion Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana potion_of_deadly_grace
0:00.000 precombat 7 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana potion_of_deadly_grace
0:00.000 default D moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana potion_of_deadly_grace
0:00.939 default E sunfire Fluffy_Pillow 13.0/100: 13% astral_power | 704000.0/704000: 100% mana bloodlust, potion_of_deadly_grace
0:01.879 single_target P half_moon Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana bloodlust, potion_of_deadly_grace
0:03.133 single_target Q full_moon Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana bloodlust, potion_of_deadly_grace
0:05.008 default F incarnation Fluffy_Pillow 76.0/100: 76% astral_power | 704000.0/704000: 100% mana bloodlust, potion_of_deadly_grace
0:05.008 celestial_alignment_phase K starsurge Fluffy_Pillow 76.0/100: 76% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, potion_of_deadly_grace
0:05.948 celestial_alignment_phase L solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power, potion_of_deadly_grace
0:06.691 celestial_alignment_phase K starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(2), potion_of_deadly_grace
0:07.612 celestial_alignment_phase L solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment(2), solar_empowerment, star_power(3), potion_of_deadly_grace
0:08.343 celestial_alignment_phase M lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment(2), star_power(4), potion_of_deadly_grace
0:09.546 celestial_alignment_phase K starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(5), potion_of_deadly_grace
0:10.442 celestial_alignment_phase L solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment(2), solar_empowerment, star_power(6), potion_of_deadly_grace
0:11.151 celestial_alignment_phase M lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment(2), star_power(7), potion_of_deadly_grace
0:12.322 celestial_alignment_phase M lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(8), potion_of_deadly_grace
0:13.480 celestial_alignment_phase K starsurge Fluffy_Pillow 54.0/100: 54% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(9), potion_of_deadly_grace
0:14.342 celestial_alignment_phase L solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(10), potion_of_deadly_grace
0:15.027 celestial_alignment_phase M lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(11), potion_of_deadly_grace
0:16.154 celestial_alignment_phase K starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(12), potion_of_deadly_grace
0:16.993 celestial_alignment_phase L solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(13), potion_of_deadly_grace
0:17.659 celestial_alignment_phase M lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(14), potion_of_deadly_grace
0:18.756 celestial_alignment_phase N solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(15), potion_of_deadly_grace
0:19.575 celestial_alignment_phase K starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(16), potion_of_deadly_grace
0:20.386 celestial_alignment_phase L solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(17), potion_of_deadly_grace
0:21.030 celestial_alignment_phase M lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(18), potion_of_deadly_grace
0:22.091 celestial_alignment_phase N solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(19), potion_of_deadly_grace
0:22.882 celestial_alignment_phase K starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(20), potion_of_deadly_grace
0:23.667 celestial_alignment_phase L solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(21)
0:24.291 celestial_alignment_phase M lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(22)
0:25.317 celestial_alignment_phase K starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(23)
0:26.080 celestial_alignment_phase L solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(24)
0:26.687 celestial_alignment_phase M lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(25)
0:27.690 celestial_alignment_phase N solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(26)
0:28.446 celestial_alignment_phase K starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(27)
0:29.201 celestial_alignment_phase L solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(28)
0:29.806 celestial_alignment_phase M lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(29)
0:30.776 celestial_alignment_phase N solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(30)
0:31.530 celestial_alignment_phase K starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(31)
0:32.286 celestial_alignment_phase L solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(32)
0:32.891 celestial_alignment_phase M lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(33)
0:33.832 celestial_alignment_phase K starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, star_power(34)
0:34.586 celestial_alignment_phase L solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(35)
0:35.224 single_target O new_moon Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana bloodlust, lunar_empowerment, acceleration
0:36.070 single_target P half_moon Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana bloodlust, lunar_empowerment, acceleration
0:37.195 single_target T lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana bloodlust, lunar_empowerment, acceleration
0:38.319 single_target R starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 704000.0/704000: 100% mana bloodlust, acceleration
0:39.166 single_target S solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana bloodlust, lunar_empowerment, solar_empowerment, acceleration
0:39.844 single_target T lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana bloodlust, lunar_empowerment, acceleration
0:40.970 single_target U solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana acceleration
0:42.067 single_target U solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana acceleration
0:43.163 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana acceleration
0:44.262 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment, acceleration
0:45.152 single_target Q full_moon Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana lunar_empowerment
0:47.587 single_target R starsurge Fluffy_Pillow 58.0/100: 58% astral_power | 704000.0/704000: 100% mana lunar_empowerment
0:48.805 single_target S solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
0:49.779 single_target T lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2)
0:51.404 single_target T lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana lunar_empowerment
0:53.030 single_target R starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 704000.0/704000: 100% mana
0:54.248 single_target S solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
0:55.225 single_target T lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana lunar_empowerment
0:56.850 single_target U solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana
0:58.070 single_target U solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana
0:59.291 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana
1:00.511 single_target O new_moon Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:01.732 single_target S solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:02.708 single_target T lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:04.335 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
1:05.555 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:06.531 single_target T lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:08.158 single_target U solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana
1:09.378 single_target U solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana
1:10.598 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
1:11.819 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:12.796 single_target T lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:14.420 single_target U solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana
1:15.642 single_target P half_moon Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana
1:17.267 single_target R starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 704000.0/704000: 100% mana
1:18.487 single_target S solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:19.462 single_target T lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:21.088 single_target U solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana
1:22.310 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
1:23.529 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:24.505 single_target T lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:26.132 single_target U solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 704000.0/704000: 100% mana
1:27.354 single_target U solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana
1:28.575 single_target R starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana
1:29.795 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:30.771 single_target Q full_moon Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:33.207 single_target R starsurge Fluffy_Pillow 60.0/100: 60% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:34.427 single_target S solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
1:35.403 single_target T lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2)
1:37.028 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:38.247 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
1:39.225 single_target T lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2)
1:40.852 single_target T lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:42.479 single_target U solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana
1:43.700 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
1:44.919 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:45.894 single_target O new_moon Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:47.115 single_target T lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:48.741 single_target U solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana
1:49.962 single_target U solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana
1:51.181 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana
1:52.402 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:53.376 single_target T lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana lunar_empowerment
1:55.000 single_target U solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana
1:56.221 single_target U solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 704000.0/704000: 100% mana
1:57.442 single_target R starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana
1:58.663 single_target S solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
1:59.638 single_target T lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:01.262 single_target P half_moon Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana
2:02.889 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana
2:04.109 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:05.084 single_target T lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:06.710 single_target U solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana
2:07.932 single_target U solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 704000.0/704000: 100% mana
2:09.151 single_target R starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana
2:10.371 single_target S solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:11.346 single_target T lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:12.973 single_target U solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana
2:14.193 single_target U solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana
2:15.413 single_target Q full_moon Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana
2:17.850 single_target R starsurge Fluffy_Pillow 78.0/100: 78% astral_power | 704000.0/704000: 100% mana
2:19.072 single_target S solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:20.049 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:21.269 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
2:22.247 single_target T lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2)
2:23.873 single_target T lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:25.499 single_target R starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana
2:26.719 single_target S solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:27.697 single_target T lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:29.324 single_target U solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana
2:30.544 single_target O new_moon Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana
2:31.764 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
2:32.984 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:33.961 single_target T lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:35.585 single_target U solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana
2:36.806 single_target U solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana
2:38.026 single_target U solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana
2:39.247 single_target R starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana
2:40.470 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:41.447 single_target T lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:43.070 single_target U solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana
2:44.291 single_target R starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana
2:45.513 single_target P half_moon Fluffy_Pillow 4.0/100: 4% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:47.137 single_target S solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:48.115 single_target T lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana lunar_empowerment
2:49.740 single_target R starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana
2:50.961 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
2:51.938 single_target T lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana lunar_empowerment, acceleration
2:53.400 single_target U solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana acceleration
2:54.498 single_target R starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana acceleration
2:55.596 single_target S solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment, acceleration
2:56.474 single_target T lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 704000.0/704000: 100% mana lunar_empowerment, acceleration
2:57.937 single_target U solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 704000.0/704000: 100% mana acceleration
2:59.033 single_target U solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana acceleration
3:00.130 single_target Q full_moon Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana acceleration
3:02.323 single_target R starsurge Fluffy_Pillow 88.0/100: 88% astral_power | 704000.0/704000: 100% mana
3:03.543 single_target R starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
3:04.764 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment(2)
3:05.740 single_target S solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
3:06.716 single_target T lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), acceleration
3:08.179 single_target T lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana lunar_empowerment, acceleration
3:09.640 default F incarnation Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana acceleration
3:09.640 default 8 potion Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, acceleration
3:09.640 celestial_alignment_phase K starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, acceleration, potion_of_deadly_grace
3:10.738 celestial_alignment_phase L solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power, acceleration, potion_of_deadly_grace
3:11.608 celestial_alignment_phase M lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(2), acceleration, potion_of_deadly_grace
3:13.041 celestial_alignment_phase N solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(3), acceleration, potion_of_deadly_grace
3:14.107 celestial_alignment_phase K starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(4), acceleration, potion_of_deadly_grace
3:15.163 celestial_alignment_phase L solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(5), acceleration, potion_of_deadly_grace
3:16.002 celestial_alignment_phase M lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(6), acceleration, potion_of_deadly_grace
3:17.382 celestial_alignment_phase K starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
3:18.523 celestial_alignment_phase L solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(8), potion_of_deadly_grace
3:19.428 celestial_alignment_phase M lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(9), potion_of_deadly_grace
3:20.921 celestial_alignment_phase N solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(10), potion_of_deadly_grace
3:22.030 celestial_alignment_phase K starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(11), potion_of_deadly_grace
3:23.128 celestial_alignment_phase L solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(12), potion_of_deadly_grace
3:24.000 celestial_alignment_phase M lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(13), potion_of_deadly_grace
3:25.440 celestial_alignment_phase N solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(14), potion_of_deadly_grace
3:26.510 celestial_alignment_phase K starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(15), potion_of_deadly_grace
3:27.572 celestial_alignment_phase L solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(16), potion_of_deadly_grace
3:28.413 celestial_alignment_phase M lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(17), acceleration, potion_of_deadly_grace
3:29.663 celestial_alignment_phase N solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(18), acceleration, potion_of_deadly_grace
3:30.594 celestial_alignment_phase K starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(19), acceleration, potion_of_deadly_grace
3:31.519 celestial_alignment_phase L solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(20), acceleration, potion_of_deadly_grace
3:32.251 celestial_alignment_phase M lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(21), acceleration, potion_of_deadly_grace
3:33.460 celestial_alignment_phase K starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(22), acceleration, potion_of_deadly_grace
3:34.362 celestial_alignment_phase L solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(23), acceleration, potion_of_deadly_grace
3:35.076 celestial_alignment_phase M lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(24), acceleration
3:36.255 celestial_alignment_phase N solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(25), acceleration
3:37.134 celestial_alignment_phase K starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, star_power(26), acceleration
3:38.006 celestial_alignment_phase L solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(27), acceleration
3:38.730 celestial_alignment_phase M lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana incarnation_chosen_of_elune, lunar_empowerment, star_power(28)
3:40.000 single_target O new_moon Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana
3:41.220 single_target P half_moon Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
3:42.845 single_target R starsurge Fluffy_Pillow 60.0/100: 60% astral_power | 704000.0/704000: 100% mana
3:44.066 single_target S solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
3:45.043 single_target Q full_moon Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana lunar_empowerment
3:47.481 single_target R starsurge Fluffy_Pillow 68.0/100: 68% astral_power | 704000.0/704000: 100% mana lunar_empowerment
3:48.701 single_target S solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
3:49.676 single_target T lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2)
3:51.300 single_target R starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana lunar_empowerment
3:52.521 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2), solar_empowerment
3:53.497 single_target T lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana lunar_empowerment(2)
3:55.122 single_target T lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana lunar_empowerment
3:56.746 single_target R starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana
3:57.967 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
3:58.944 single_target T lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:00.569 single_target O new_moon Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana
4:01.789 single_target U solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana
4:03.009 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana
4:04.229 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:05.204 single_target T lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:06.828 single_target U solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana
4:08.049 single_target U solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 704000.0/704000: 100% mana
4:09.268 single_target R starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana
4:10.488 single_target S solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:11.466 single_target T lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:13.091 single_target U solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana
4:14.311 single_target U solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana
4:15.530 single_target P half_moon Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana
4:17.156 single_target R starsurge Fluffy_Pillow 58.0/100: 58% astral_power | 704000.0/704000: 100% mana
4:18.376 single_target S solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:19.354 single_target T lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:20.978 single_target R starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 704000.0/704000: 100% mana acceleration
4:22.075 single_target S solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment, acceleration
4:22.955 single_target T lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment, acceleration
4:24.417 single_target U solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana acceleration
4:25.517 single_target U solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 704000.0/704000: 100% mana acceleration
4:26.613 single_target U solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana acceleration
4:27.711 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana acceleration
4:28.809 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment, acceleration
4:29.687 single_target T lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana lunar_empowerment, acceleration
4:31.148 single_target Q full_moon Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana
4:33.585 single_target R starsurge Fluffy_Pillow 66.0/100: 66% astral_power | 704000.0/704000: 100% mana
4:34.806 single_target S solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:35.782 single_target T lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:37.406 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana
4:38.626 single_target S solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:39.603 single_target T lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:41.228 single_target U solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 704000.0/704000: 100% mana
4:42.450 single_target R starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 704000.0/704000: 100% mana
4:43.670 single_target S solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:44.647 single_target T lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:46.272 single_target O new_moon Fluffy_Pillow 26.0/100: 26% astral_power | 704000.0/704000: 100% mana
4:47.494 single_target U solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 704000.0/704000: 100% mana
4:48.716 single_target R starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 704000.0/704000: 100% mana
4:49.936 single_target S solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:50.914 single_target T lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:52.538 single_target U solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 704000.0/704000: 100% mana
4:53.757 single_target U solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 704000.0/704000: 100% mana
4:54.978 single_target R starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 704000.0/704000: 100% mana
4:56.201 single_target S solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment
4:57.176 single_target T lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment
4:58.800 single_target U solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 704000.0/704000: 100% mana
5:00.020 single_target P half_moon Fluffy_Pillow 28.0/100: 28% astral_power | 704000.0/704000: 100% mana
5:01.647 single_target R starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 704000.0/704000: 100% mana
5:02.869 single_target S solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 704000.0/704000: 100% mana lunar_empowerment, solar_empowerment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 9359 9034 0
Stamina 41361 41361 24840
Intellect 36689 34983 25990 (13036)
Spirit 0 0 0
Health 2481660 2481660 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 36689 34983 0
Crit 23.24% 23.24% 6896
Haste 23.33% 22.33% 8372
Damage / Heal Versatility 4.46% 4.46% 2117
Attack Power 9359 9034 0
Mastery 44.89% 44.89% 4779
Armor 8134 2169 2169
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 866.00
Local Head Helm of the Mountain Recluse
ilevel: 860, stats: { 276 Armor, +2242 Sta, +1495 AgiInt, +894 Haste, +528 Vers }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 910, stats: { +2010 Sta, +1247 Mastery, +1247 Crit, +1247 Haste }, gems: { +150 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Rivermane Shoulders
ilevel: 845, stats: { 243 Armor, +975 AgiInt, +1463 Sta, +685 Haste, +324 Crit }
Local Shirt Black Swashbuckler's Shirt
ilevel: 1
Local Chest Ekowraith, Creator of Worlds
ilevel: 910, stats: { 402 Armor, +3573 Sta, +2382 AgiInt, +612 Crit, +1103 Mastery }
Local Waist Girdle of Lidless Sight
ilevel: 870, stats: { 198 Armor, +1846 Sta, +1231 AgiInt, +744 Mastery, +364 Haste }
Local Legs Fevermelt Legguards
ilevel: 850, stats: { 288 Armor, +1362 AgiInt, +2042 Sta, +979 Haste, +391 Crit }
Local Feet Stained Maggot Squishers
ilevel: 885, stats: { 254 Armor, +2122 Sta, +1415 AgiInt, +686 Mastery, +485 Haste }
Local Wrists Tranquil Bough Wristwraps
ilevel: 850, stats: { 144 Armor, +766 AgiInt, +1149 Sta, +517 Haste, +253 Mastery }
Local Hands Custodian's Soothing Touch
ilevel: 880, stats: { 227 Armor, +1351 AgiInt, +2027 Sta, +772 Crit, +378 Vers }, gems: { +150 Haste }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 865, stats: { +1321 Sta, +1626 Crit, +745 Haste }, enchant: { +200 Haste }
Local Finger2 Band of Fused Coral
ilevel: 840, stats: { +1047 Sta, +1456 Haste, +583 Crit }, enchant: { +200 Haste }
Local Trinket1 Huge Roggstone
ilevel: 845, stats: { +1236 Int, +961 Vers }, gems: { +150 Haste }
Local Trinket2 Chrono Shard
ilevel: 840, stats: { +1179 StrAgiInt }
Local Back Drape of the Mana-Starved
ilevel: 865, stats: { 137 Armor, +1321 Sta, +880 StrAgiInt, +564 Crit, +250 Vers }, gems: { +150 Haste }, enchant: { +200 Int }
Local Main Hand Scythe of Elune
ilevel: 879, weapon: { 4397 - 6597, 3.6 }, stats: { +1784 Int, +2677 Sta, +777 Crit, +746 Mastery, +9734 Int }, relics: { +42 ilevels, +45 ilevels, +42 ilevels }
Local Tabard Tabard of the Guardians of Hyjal
ilevel: 85

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Nebriniel"
origin="https://eu.api.battle.net/wow/character/hyjal/Nebriniel/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/121/147007609-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=spell
position=back
professions=inscription=714/alchemy=780
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!2122102
artifact=59:0:0:0:0:1034:3:1035:3:1036:3:1037:3:1038:3:1039:3:1040:3:1041:3:1042:3:1043:1:1044:1:1045:1:1046:1:1047:1:1048:1:1049:1:1294:1:1364:4
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher&active_enemies<=2
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,cycle_targets=1,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=((active_enemies>=2&talent.stellar_drift.enabled)|active_enemies>=3)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up|buff.bloodlust.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.celestial_alignment.up&buff.celestial_alignment.remains<(10))|(buff.incarnation.up&buff.incarnation.remains<(3*execute_time)&astral_power>78)|(buff.incarnation.up&buff.incarnation.remains<(2*execute_time)&astral_power>52)|(buff.incarnation.up&buff.incarnation.remains<execute_time&astral_power>26)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=((talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled))&(buff.the_emerald_dreamcatcher.remains>gcd.max|!buff.the_emerald_dreamcatcher.up)
actions.ed+=/sunfire,if=((talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled))&(buff.the_emerald_dreamcatcher.remains>gcd.max|!buff.the_emerald_dreamcatcher.up)
actions.ed+=/starfall,if=buff.oneths_overconfidence.up&buff.the_emerald_dreamcatcher.remains>execute_time&remains<2
actions.ed+=/half_moon,if=astral_power<=80&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=6
actions.ed+=/full_moon,if=astral_power<=60&buff.the_emerald_dreamcatcher.remains>execute_time
actions.ed+=/solar_wrath,if=buff.solar_empowerment.stack>1&buff.the_emerald_dreamcatcher.remains>2*execute_time&astral_power>=6&(dot.moonfire.remains>5|(dot.sunfire.remains<5.4&dot.moonfire.remains>6.6))&(!(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=90|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=85)
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=11&(!(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=85|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77.5)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=16&(!(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=90|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=85)
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)|(buff.the_emerald_dreamcatcher.up&astral_power>=77.5&(buff.celestial_alignment.up|buff.incarnation.up))
actions.ed+=/starfall,if=buff.oneths_overconfidence.up&remains<2
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60&((cooldown.incarnation.remains>65&cooldown.full_moon.charges>0)|(cooldown.incarnation.remains>50&cooldown.full_moon.charges>1)|(cooldown.incarnation.remains>25&cooldown.full_moon.charges>2))
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=((active_enemies>=2&talent.stellar_drift.enabled)|active_enemies>=3)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=helm_of_the_mountain_recluse,id=141418,bonus_id=3466/1472
neck=prydaz_xavarics_magnum_opus,id=132444,bonus_id=3459/3458,gems=150haste,enchant=mark_of_the_hidden_satyr
shoulders=rivermane_shoulders,id=139110,bonus_id=3474/1507/1674
back=drape_of_the_manastarved,id=141543,bonus_id=1808/3466/1477/3336,gems=150haste,enchant=200int
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811/3458
shirt=black_swashbucklers_shirt,id=4336
tabard=tabard_of_the_guardians_of_hyjal,id=65906
wrists=tranquil_bough_wristwraps,id=139066,bonus_id=3432/1512/3337
hands=custodians_soothing_touch,id=142141,bonus_id=1808/3453/1492/3337,gems=150haste
waist=girdle_of_lidless_sight,id=137513,bonus_id=3415/1522/3337
legs=fevermelt_legguards,id=134460,bonus_id=3410/1502/3336
feet=stained_maggot_squishers,id=139200,bonus_id=1806/1507/3336
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1487,enchant=200haste
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1492/1813,enchant=200haste
trinket1=huge_roggstone,id=134160,bonus_id=3474/1808/607/1507/1674,gems=150haste
trinket2=chrono_shard,id=137419,bonus_id=1727/1492/1813
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=143692/140078/141266/0,relic_id=3474:1507:1674/0/3474:1507:1674/0

# Gear Summary
# gear_ilvl=866.27
# gear_stamina=24840
# gear_intellect=25990
# gear_crit_rating=6896
# gear_haste_rating=8372
# gear_mastery_rating=4779
# gear_versatility_rating=2117
# gear_armor=2169

Rinotor

Rinotor : 448892 dps

  • Race: Worgen
  • Class: Hunter
  • Spec: Beast Mastery
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
448892.1 448892.1 236.6 / 0.053% 46810.1 / 10.4% 7669.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
17.2 17.2 Focus 16.41% 47.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Rinotor/advanced
Talents
  • 15: Dire Stable (Beast Mastery Hunter)
  • 30: Chimaera Shot (Beast Mastery Hunter)
  • 45: Posthaste
  • 60: Blink Strikes (Beast Mastery Hunter)
  • 75: Intimidation (Beast Mastery Hunter)
  • 90: A Murder of Crows
  • 100: Killer Cobra (Beast Mastery Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 610
  • jewelcrafting: 781

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rinotor 448892
A Murder of Crows 0 (29493) 0.0% (6.6%) 5.5 60.41sec 1610927 1556157

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 0.00 85.42 0.00 1.0353 0.9357 0.00 0.00 0.00 103319.65 1556156.79
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 29493 6.6% 0.0 0.00sec 0 0 Direct 85.4 81445 165158 103554 26.4%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 85.42 0.00 0.00 0.0000 0.0000 8845195.17 13003274.74 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.86 73.59% 81445.23 67844 96447 81543.48 74665 90676 5119544 7526214 31.98
crit 22.56 26.41% 165157.56 135688 192894 165359.05 145824 184668 3725652 5477061 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 16894 3.8% 122.8 2.46sec 41322 17015 Direct 122.8 32791 66155 41322 25.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.83 122.83 0.00 0.00 2.4285 0.0000 5075498.53 7461463.60 31.98 17015.03 17015.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.43 74.43% 32791.45 28236 39211 32810.94 31693 34129 2997973 4407304 31.98
crit 31.40 25.57% 66154.77 56472 78423 66187.49 59203 73744 2077526 3054160 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Chimaera Shot 0 (23729) 0.0% (5.3%) 35.6 8.42sec 200066 161888

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.64 0.00 0.00 0.00 1.2359 0.0000 0.00 0.00 0.00 161888.03 161888.03
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus<90
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. Generates {$204304s1=10} Focus for every target hit.
 
    Chimaera Shot (_frost) 11873 2.6% 0.0 0.00sec 0 0 Direct 17.8 159193 320032 200209 25.5%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 17.83 0.00 0.00 0.0000 0.0000 3569006.36 3569006.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.28 74.50% 159192.95 136711 189630 159303.19 137861 185679 2114232 2114232 0.00
crit 4.55 25.50% 320032.04 273423 379261 316940.22 0 379261 1454775 1454775 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. Generates {$204304s1=10} Focus for every target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.88
 
    Chimaera Shot (_nature) 11856 2.6% 0.0 0.00sec 0 0 Direct 17.8 159169 320718 200084 25.3%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 17.80 0.00 0.00 0.0000 0.0000 3562323.34 3562323.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.29 74.67% 159168.86 136711 189630 159244.40 137717 185679 2115906 2115906 0.00
crit 4.51 25.33% 320718.25 273423 379261 317911.60 0 379261 1446418 1446418 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. Generates {$204304s1=10} Focus for every target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.88
 
Cobra Shot 56405 12.6% 68.7 4.38sec 246852 200949 Direct 68.6 194954 393537 246992 26.2%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.66 68.62 0.00 0.00 1.2284 0.0000 16948832.20 24916388.77 31.98 200948.88 200948.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.64 73.80% 194954.42 164199 227758 195087.36 182457 206057 9872664 14513752 31.98
crit 17.98 26.20% 393537.11 328398 455515 393873.21 340510 449890 7076168 10402637 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.kill_command.remains>focus.time_to_max&cooldown.bestial_wrath.remains>focus.time_to_max|(buff.bestial_wrath.up&focus.regen*cooldown.kill_command.remains>30)|target.time_to_die<cooldown.kill_command.remains
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing ${$sw2*$<mult>} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Dire Beast 0 (25873) 0.0% (5.8%) 32.5 9.39sec 239284 231584

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.46 0.00 0.00 0.00 1.0333 0.0000 0.00 0.00 0.00 231583.74 231583.74
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>3
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 35920 5.8% 164.6 1.83sec 47196 29114 Direct 164.6 37556 75120 47196 25.7%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.56 164.56 0.00 0.00 1.6210 0.0000 7766623.81 11417672.67 31.98 29114.43 29114.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.33 74.34% 37555.69 36181 39263 37574.98 37028 38217 4594228 6753950 31.98
crit 42.23 25.66% 75119.57 72362 78527 75157.16 73132 77294 3172396 4663723 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (173855) 0.0% (38.7%) 75.1 4.01sec 694902 677805

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.09 0.00 0.00 0.00 1.0252 0.0000 0.00 0.00 0.00 677805.12 677805.12
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 111099 24.7% 75.1 4.01sec 444069 0 Direct 75.1 319041 647506 444077 38.1%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.09 75.09 0.00 0.00 0.0000 0.0000 33345578.74 49021159.33 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.51 61.94% 319041.43 260063 369707 319246.86 302133 338677 14837992 21813254 31.98
crit 28.58 38.06% 647505.64 520127 739414 648088.72 594048 698102 18507586 27207905 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 22203 4.9% 30.0 9.90sec 221962 0 Direct 30.0 221968 0 221968 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.02 30.02 0.00 0.00 0.0000 0.0000 6662755.87 6662755.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.02 100.00% 221967.78 130032 369707 222152.70 168737 296676 6662756 6662756 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:130031.66
  • base_dd_max:130031.66
 
    Kill Command (hati) 33798 7.5% 75.1 4.01sec 135109 0 Direct 75.1 106689 215333 135110 26.2%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.09 75.09 0.00 0.00 0.0000 0.0000 10145466.15 14914796.25 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.45 73.84% 106689.39 86688 123236 106758.65 102072 111805 5915724 8696675 31.98
crit 19.64 26.16% 215332.79 173376 246471 215489.85 190977 240022 4229742 6218121 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (hati) 6755 1.5% 30.0 9.91sec 67565 0 Direct 30.0 67565 0 67565 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 0.0000 0.0000 2027026.08 2027026.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.00 100.00% 67565.21 43344 123236 67622.53 52586 87825 2027026 2027026 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:43343.89
  • base_dd_max:43343.89
 
Titan's Thunder 0 (22902) 0.0% (5.1%) 5.4 61.30sec 1278716 0

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.dire_frenzy.enabled|cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
 
    Titan's Thunder (cat) 6056 1.3% 5.4 61.30sec 338164 0 Periodic 42.3 33719 68282 42918 26.6% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 0.00 42.30 42.30 0.0000 1.0000 1815613.84 1815613.84 0.00 42918.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.0 73.39% 33719.13 27707 39388 33769.71 29318 38123 1046811 1046811 0.00
crit 11.3 26.61% 68282.36 55414 78777 68409.92 55414 78777 768802 768802 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 11286 1.8% 5.1 64.31sec 480645 0 Periodic 40.0 48019 96449 60980 26.8% 13.3%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 40.03 40.03 0.0000 1.0000 2441294.52 2441294.52 0.00 60980.53 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.3 73.24% 48018.90 46545 50510 48050.12 46687 50510 1407951 1407951 0.00
crit 10.7 26.76% 96448.58 93091 101021 96527.34 93091 101021 1033344 1033344 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 5453 0.2% 0.5 114.65sec 465584 0 Periodic 3.6 47468 94895 59425 25.2% 1.2%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.45 0.00 3.56 3.56 0.0000 1.0000 211289.39 211289.39 0.00 59434.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.7 74.79% 47468.41 46545 50510 17897.87 0 50510 126226 126226 0.00
crit 0.9 25.21% 94894.98 93091 101021 32810.36 0 101021 85063 85063 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 4965 0.0% 0.1 0.00sec 458252 0 Periodic 0.7 47354 94844 59354 25.3% 0.2%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.09 0.00 0.73 0.73 0.0000 1.0000 43399.87 43399.87 0.00 59370.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.5 74.73% 47353.80 46545 50510 4397.23 0 50510 25875 25875 0.00
crit 0.2 25.27% 94843.98 93091 101021 7868.48 0 101021 17525 17525 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 4381 0.0% 0.1 0.00sec 474762 0 Periodic 0.6 46545 93091 59345 27.5% 0.2%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.07 0.00 0.60 0.60 0.0000 1.0000 35429.98 35429.98 0.00 59346.69 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.4 72.50% 46545.26 46545 46545 3473.53 0 46545 20146 20146 0.00
crit 0.2 27.50% 93090.52 93091 93091 6947.05 0 93091 15284 15284 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (hati) 7732 1.7% 5.4 61.30sec 431818 0 Periodic 42.3 43082 87258 54803 26.5% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 0.00 42.30 42.30 0.0000 1.0000 2318444.78 2318444.78 0.00 54804.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.1 73.46% 43081.67 35402 50327 43147.04 37042 48352 1338916 1338916 0.00
crit 11.2 26.54% 87258.22 70804 100654 87414.26 70804 100654 979529 979529 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 5325 1.2% 10.5 28.02sec 152905 0 Direct 72.0 17655 35604 22251 25.6%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 71.95 0.00 0.00 0.0000 0.0000 1600983.41 1600983.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.53 74.40% 17655.43 15530 20344 17660.41 15530 20344 945087 945087 0.00
crit 18.42 25.60% 35604.46 31059 40687 35593.12 31059 40687 655896 655896 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
pet - cat 209156 / 209156
Claw 46515 10.4% 100.8 3.00sec 138719 138098 Direct 100.8 100547 204825 138718 36.6%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.78 100.78 0.00 0.00 1.0045 0.0000 13980473.78 20552620.73 31.98 138097.85 138097.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.89 63.39% 100547.40 46066 130975 100617.34 93585 108049 6424008 9443900 31.98
crit 36.89 36.61% 204824.77 92132 261950 205022.35 174008 230947 7556466 11108720 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 23283 5.2% 201.2 1.49sec 34772 23311 Direct 201.2 25208 51135 34773 36.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.15 201.15 0.00 0.00 1.4917 0.0000 6994577.10 10282690.88 31.98 23310.59 23310.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.95 63.11% 25207.78 21537 30618 25225.68 24289 26288 3200055 4704385 31.98
crit 74.21 36.89% 51134.76 43075 61235 51176.98 48467 54263 3794522 5578306 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 73147 / 73147
hati_melee 24862 5.5% 182.8 1.64sec 40850 24896 Direct 183.8 32261 65072 40628 25.5%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.82 183.82 0.00 0.00 1.6408 0.0000 7468212.65 10978980.01 31.98 24896.20 24896.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.94 74.50% 32260.66 27214 39120 32282.58 31366 33618 4417858 6494669 31.98
crit 46.88 25.50% 65072.38 54428 78241 65121.47 60757 70706 3050355 4484311 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Rinotor
Aspect of the Wild 2.8 129.78sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 37.75 0.00 0.0000 0.7406 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up|target.time_to_die<12
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
Bestial Wrath 8.8 36.17sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 2.8 0.0 129.7sec 129.7sec 12.05% 8.85% 36.1(36.1) 2.7

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 8.8 0.0 36.1sec 36.1sec 42.78% 50.23% 0.0(0.0) 8.4

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.31

Stack Uptimes

  • bestial_wrath_1:42.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Blood Frenzy 10.6 6.6 28.7sec 17.2sec 45.70% 45.70% 6.6(6.6) 10.1

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3223.30

Stack Uptimes

  • blood_frenzy_1:45.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 15.38% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 32.5 0.0 10.9sec 9.4sec 79.34% 76.39% 0.0(0.0) 25.3

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00

Stack Uptimes

  • dire_beast_1:73.54%
  • dire_beast_2:5.62%
  • dire_beast_3:0.17%
  • dire_beast_4:0.00%
  • dire_beast_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 58.3sec 0.0sec 39.89% 39.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
cat: Aspect of the Wild 2.8 0.0 129.7sec 129.7sec 12.05% 14.27% 36.1(36.1) 2.7

Buff details

  • buff initial source:Rinotor_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 8.8 0.0 36.1sec 36.1sec 42.78% 47.79% 0.0(0.0) 8.4

Buff details

  • buff initial source:Rinotor_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.31

Stack Uptimes

  • bestial_wrath_1:42.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
hati: Bestial Wrath 8.8 0.0 36.1sec 36.1sec 42.78% 49.47% 0.0(0.0) 8.4

Buff details

  • buff initial source:Rinotor_hati
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.31

Stack Uptimes

  • bestial_wrath_1:42.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
starved: a_murder_of_crows 1.4 4.6sec
wild_call 6.3 40.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Rinotor
a_murder_of_crows Focus 5.5 164.7 30.0 30.0 53701.4
cobra_shot Focus 68.7 2746.4 40.0 40.0 6171.2
kill_command Focus 75.1 2252.7 30.0 30.0 23163.5
pet - cat
claw Focus 100.8 4722.6 46.9 46.9 2960.3
Resource Gains Type Count Total Average Overflow
dire_beast Focus 792.12 734.19 (14.42%) 0.93 7.61 1.03%
aspect_of_the_wild Focus 91.33 346.30 (6.80%) 3.79 15.49 4.28%
chimaera_shot_frost Focus 17.83 178.34 (3.50%) 10.00 0.00 0.00%
chimaera_shot_nature Focus 17.81 178.11 (3.50%) 10.00 0.00 0.00%
focus_regen Focus 1037.94 3656.01 (71.79%) 3.52 10.79 0.29%
pet - cat
focus_regen Focus 626.46 4380.41 (94.26%) 6.99 200.71 4.38%
aspect_of_the_wild Focus 89.02 266.93 (5.74%) 3.00 94.86 26.22%
Resource RPS-Gain RPS-Loss
Health 678.13 0.00
Focus 16.93 17.17
Combat End Resource Mean Min Max
Focus 47.74 0.08 120.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 87.4%
Uptimes %
Focus Cap 0.2%
cat-Focus Cap 2.4%

Statistics & Data Analysis

Fight Length
Sample Data Rinotor Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Rinotor Damage Per Second
Count 9999
Mean 448892.10
Minimum 406791.61
Maximum 504059.72
Spread ( max - min ) 97268.11
Range [ ( max - min ) / 2 * 100% ] 10.83%
Standard Deviation 12069.6454
5th Percentile 429713.10
95th Percentile 469547.65
( 95th Percentile - 5th Percentile ) 39834.55
Mean Distribution
Standard Deviation 120.7025
95.00% Confidence Intervall ( 448655.52 - 449128.67 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2778
0.1 Scale Factor Error with Delta=300 1243578
0.05 Scale Factor Error with Delta=300 4974309
0.01 Scale Factor Error with Delta=300 124357703
Priority Target DPS
Sample Data Rinotor Priority Target Damage Per Second
Count 9999
Mean 448892.10
Minimum 406791.61
Maximum 504059.72
Spread ( max - min ) 97268.11
Range [ ( max - min ) / 2 * 100% ] 10.83%
Standard Deviation 12069.6454
5th Percentile 429713.10
95th Percentile 469547.65
( 95th Percentile - 5th Percentile ) 39834.55
Mean Distribution
Standard Deviation 120.7025
95.00% Confidence Intervall ( 448655.52 - 449128.67 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2778
0.1 Scale Factor Error with Delta=300 1243578
0.05 Scale Factor Error with Delta=300 4974309
0.01 Scale Factor Error with Delta=300 124357703
DPS(e)
Sample Data Rinotor Damage Per Second (Effective)
Count 9999
Mean 448892.10
Minimum 406791.61
Maximum 504059.72
Spread ( max - min ) 97268.11
Range [ ( max - min ) / 2 * 100% ] 10.83%
Damage
Sample Data Rinotor Damage
Count 9999
Mean 39601839.00
Minimum 28049952.37
Maximum 51456427.22
Spread ( max - min ) 23406474.84
Range [ ( max - min ) / 2 * 100% ] 29.55%
DTPS
Sample Data Rinotor Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rinotor Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rinotor Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rinotor Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rinotor Healing Taken Per Second
Count 9999
Mean 689.63
Minimum 543.40
Maximum 889.37
Spread ( max - min ) 345.97
Range [ ( max - min ) / 2 * 100% ] 25.08%
TMI
Sample Data Rinotor Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RinotorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rinotor Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=prolonged_power
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 berserking
0.00 blood_fury
0.00 volley,toggle=on
7 1.00 potion,name=prolonged_power,if=buff.bestial_wrath.remains|!cooldown.beastial_wrath.remains
8 5.49 a_murder_of_crows
0.00 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
9 32.46 dire_beast,if=cooldown.bestial_wrath.remains>3
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>6|target.time_to_die<9
A 2.84 aspect_of_the_wild,if=buff.bestial_wrath.up|target.time_to_die<12
0.00 barrage,if=spell_targets.barrage>1
B 5.37 titans_thunder,if=talent.dire_frenzy.enabled|cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
C 8.75 bestial_wrath
0.00 multi_shot,if=spell_targets>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
D 75.09 kill_command
0.00 multi_shot,if=spell_targets>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
E 35.65 chimaera_shot,if=focus<90
F 68.66 cobra_shot,if=cooldown.kill_command.remains>focus.time_to_max&cooldown.bestial_wrath.remains>focus.time_to_max|(buff.bestial_wrath.up&focus.regen*cooldown.kill_command.remains>30)|target.time_to_die<cooldown.kill_command.remains

Sample Sequence

0124568C9ABDFDEFDFDF99DFDEFDF9DEFFDFE9CDFDFEDF9DEDFD99DEFFDFE97CDF8BDFED9DFDE9DFEFDF9DEFDFE9CDFDFDEFD9DE9DF8DEF9BDFEDFF9CADEFDFDFD99DFDEFFD9DFEFDF9CDEFDFDE89DFDBED9DFEFDF9DEFDFEC9DFDFDEFD9DFED9DE9D8FCFDE9BDFDFDAEFD9DFFFEDF9DFEFDF9CDEFDFDE9DFDE8D

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Rinotor 120.0/120: 100% focus
Pre precombat 1 food Rinotor 120.0/120: 100% focus
Pre precombat 2 summon_pet Fluffy_Pillow 120.0/120: 100% focus
Pre precombat 4 potion Fluffy_Pillow 120.0/120: 100% focus potion_of_prolonged_power
Pre precombat 5 augmentation Rinotor 120.0/120: 100% focus potion_of_prolonged_power
0:00.000 default 6 start_auto_shot Fluffy_Pillow 120.0/120: 100% focus potion_of_prolonged_power
0:00.000 default 8 a_murder_of_crows Fluffy_Pillow 120.0/120: 100% focus bloodlust, potion_of_prolonged_power
0:00.754 default C bestial_wrath Fluffy_Pillow 101.1/120: 84% focus bloodlust, potion_of_prolonged_power
0:00.754 default 9 dire_beast Fluffy_Pillow 101.1/120: 84% focus bloodlust, bestial_wrath, potion_of_prolonged_power
0:01.507 default A aspect_of_the_wild Fluffy_Pillow 114.5/120: 95% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:01.507 default B titans_thunder Fluffy_Pillow 114.5/120: 95% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:01.507 default D kill_command Fluffy_Pillow 114.5/120: 95% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:02.262 default F cobra_shot Fluffy_Pillow 105.4/120: 88% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:03.285 default D kill_command Fluffy_Pillow 93.8/120: 78% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:04.041 default E chimaera_shot Fluffy_Pillow 84.8/120: 71% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:05.061 default F cobra_shot Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:06.083 default D kill_command Fluffy_Pillow 108.4/120: 90% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:06.838 default F cobra_shot Fluffy_Pillow 99.3/120: 83% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:07.860 default D kill_command Fluffy_Pillow 87.6/120: 73% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:08.615 default F cobra_shot Fluffy_Pillow 78.6/120: 65% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:09.636 default 9 dire_beast Fluffy_Pillow 63.9/120: 53% focus bloodlust, aspect_of_the_wild, bestial_wrath, potion_of_prolonged_power
0:10.391 default 9 dire_beast Fluffy_Pillow 84.8/120: 71% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_prolonged_power
0:11.147 default D kill_command Fluffy_Pillow 108.0/120: 90% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_prolonged_power
0:11.902 default F cobra_shot Fluffy_Pillow 101.2/120: 84% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_prolonged_power
0:12.924 default D kill_command Fluffy_Pillow 92.7/120: 77% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_prolonged_power
0:13.680 default E chimaera_shot Fluffy_Pillow 85.9/120: 72% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_prolonged_power
0:14.701 default F cobra_shot Fluffy_Pillow 120.0/120: 100% focus bloodlust, bestial_wrath, dire_beast(2), potion_of_prolonged_power
0:15.721 default D kill_command Fluffy_Pillow 101.2/120: 84% focus bloodlust, bestial_wrath, dire_beast(2), potion_of_prolonged_power
0:16.475 default F cobra_shot Fluffy_Pillow 86.8/120: 72% focus bloodlust, dire_beast(2), potion_of_prolonged_power
0:17.496 Waiting     0.800 sec 68.0/120: 57% focus bloodlust, dire_beast(2), potion_of_prolonged_power
0:18.296 default 9 dire_beast Fluffy_Pillow 82.5/120: 69% focus bloodlust, dire_beast, potion_of_prolonged_power
0:19.285 default D kill_command Fluffy_Pillow 99.6/120: 83% focus bloodlust, dire_beast, potion_of_prolonged_power
0:20.040 default E chimaera_shot Fluffy_Pillow 83.0/120: 69% focus bloodlust, dire_beast, potion_of_prolonged_power
0:21.061 default F cobra_shot Fluffy_Pillow 111.1/120: 93% focus bloodlust, dire_beast, potion_of_prolonged_power
0:22.083 default F cobra_shot Fluffy_Pillow 89.2/120: 74% focus bloodlust, dire_beast, potion_of_prolonged_power
0:23.103 Waiting     0.900 sec 68.0/120: 57% focus bloodlust, dire_beast, blood_frenzy, potion_of_prolonged_power
0:24.003 default D kill_command Fluffy_Pillow 85.0/120: 71% focus bloodlust, dire_beast, blood_frenzy, potion_of_prolonged_power
0:24.992 default F cobra_shot Fluffy_Pillow 73.7/120: 61% focus bloodlust, dire_beast, blood_frenzy, potion_of_prolonged_power
0:25.941 default E chimaera_shot Fluffy_Pillow 51.6/120: 43% focus bloodlust, dire_beast, blood_frenzy, potion_of_prolonged_power
0:26.889 default 9 dire_beast Fluffy_Pillow 77.8/120: 65% focus bloodlust, blood_frenzy, potion_of_prolonged_power
0:27.642 default C bestial_wrath Fluffy_Pillow 92.0/120: 77% focus bloodlust, dire_beast, blood_frenzy, potion_of_prolonged_power
0:27.642 default D kill_command Fluffy_Pillow 92.0/120: 77% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:28.397 default F cobra_shot Fluffy_Pillow 76.2/120: 64% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:29.345 default D kill_command Fluffy_Pillow 54.1/120: 45% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:30.101 Waiting     0.100 sec 38.4/120: 32% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:30.201 default F cobra_shot Fluffy_Pillow 40.3/120: 34% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:31.151 Waiting     0.300 sec 18.2/120: 15% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:31.451 default E chimaera_shot Fluffy_Pillow 23.8/120: 20% focus bloodlust, bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
0:32.565 default D kill_command Fluffy_Pillow 54.7/120: 46% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:33.320 Waiting     0.200 sec 38.1/120: 32% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:33.520 default F cobra_shot Fluffy_Pillow 41.7/120: 35% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:34.543 default 9 dire_beast Fluffy_Pillow 19.8/120: 17% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:35.363 default D kill_command Fluffy_Pillow 34.4/120: 29% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:36.117 Waiting     1.300 sec 17.7/120: 15% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:37.417 default E chimaera_shot Fluffy_Pillow 40.8/120: 34% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:38.677 Waiting     1.700 sec 73.1/120: 61% focus bloodlust, bestial_wrath, dire_beast, potion_of_prolonged_power
0:40.377 default D kill_command Fluffy_Pillow 101.9/120: 85% focus bestial_wrath, dire_beast, potion_of_prolonged_power
0:41.753 default F cobra_shot Fluffy_Pillow 91.7/120: 76% focus bestial_wrath, dire_beast, potion_of_prolonged_power
0:43.080 default D kill_command Fluffy_Pillow 66.7/120: 56% focus potion_of_prolonged_power
0:44.250 default 9 dire_beast Fluffy_Pillow 50.0/120: 42% focus potion_of_prolonged_power
0:45.422 default 9 dire_beast Fluffy_Pillow 66.8/120: 56% focus dire_beast, potion_of_prolonged_power
0:46.590 default D kill_command Fluffy_Pillow 87.0/120: 73% focus dire_beast(2), potion_of_prolonged_power
0:47.760 default E chimaera_shot Fluffy_Pillow 77.3/120: 64% focus dire_beast(2), potion_of_prolonged_power
0:49.085 default F cobra_shot Fluffy_Pillow 110.3/120: 92% focus dire_beast(2), potion_of_prolonged_power
0:50.411 default F cobra_shot Fluffy_Pillow 93.3/120: 78% focus dire_beast(2), potion_of_prolonged_power
0:51.736 Waiting     1.300 sec 76.3/120: 64% focus dire_beast(2), potion_of_prolonged_power
0:53.036 default D kill_command Fluffy_Pillow 96.4/120: 80% focus dire_beast, potion_of_prolonged_power
0:54.374 default F cobra_shot Fluffy_Pillow 82.2/120: 68% focus potion_of_prolonged_power
0:55.700 default E chimaera_shot Fluffy_Pillow 57.2/120: 48% focus potion_of_prolonged_power
0:57.026 default 9 dire_beast Fluffy_Pillow 82.3/120: 69% focus potion_of_prolonged_power
0:58.196 default 7 potion Fluffy_Pillow 99.0/120: 83% focus dire_beast
0:58.196 default C bestial_wrath Fluffy_Pillow 99.0/120: 83% focus dire_beast, potion_of_prolonged_power
0:58.196 default D kill_command Fluffy_Pillow 99.0/120: 83% focus bestial_wrath, dire_beast, potion_of_prolonged_power
0:59.365 default F cobra_shot Fluffy_Pillow 85.8/120: 72% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:00.690 default 8 a_murder_of_crows Fluffy_Pillow 64.8/120: 54% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:01.859 default B titans_thunder Fluffy_Pillow 51.6/120: 43% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:01.859 default D kill_command Fluffy_Pillow 51.6/120: 43% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:03.028 Waiting     0.200 sec 38.3/120: 32% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:03.228 default F cobra_shot Fluffy_Pillow 41.2/120: 34% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:04.554 default E chimaera_shot Fluffy_Pillow 20.2/120: 17% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:05.881 default D kill_command Fluffy_Pillow 45.7/120: 38% focus bestial_wrath, potion_of_prolonged_power
1:07.050 Waiting     0.400 sec 28.9/120: 24% focus bestial_wrath, potion_of_prolonged_power
1:07.450 default 9 dire_beast Fluffy_Pillow 33.5/120: 28% focus bestial_wrath, potion_of_prolonged_power
1:08.780 Waiting     0.500 sec 52.0/120: 43% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:09.280 default D kill_command Fluffy_Pillow 59.2/120: 49% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:10.665 default F cobra_shot Fluffy_Pillow 49.1/120: 41% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:11.993 Waiting     0.100 sec 29.3/120: 24% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:12.093 default D kill_command Fluffy_Pillow 30.8/120: 26% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:13.105 default E chimaera_shot Fluffy_Pillow 16.2/120: 13% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:14.338 Waiting     3.100 sec 44.9/120: 37% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:17.438 default 9 dire_beast Fluffy_Pillow 86.6/120: 72% focus blood_frenzy, potion_of_prolonged_power
1:18.673 default D kill_command Fluffy_Pillow 104.7/120: 87% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:19.686 default F cobra_shot Fluffy_Pillow 90.1/120: 75% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:20.918 default E chimaera_shot Fluffy_Pillow 68.6/120: 57% focus dire_beast, potion_of_prolonged_power
1:22.243 default F cobra_shot Fluffy_Pillow 97.6/120: 81% focus dire_beast, potion_of_prolonged_power
1:23.569 Waiting     1.300 sec 76.6/120: 64% focus dire_beast, potion_of_prolonged_power
1:24.869 default D kill_command Fluffy_Pillow 95.8/120: 80% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:26.082 default F cobra_shot Fluffy_Pillow 81.2/120: 68% focus blood_frenzy, potion_of_prolonged_power
1:27.315 Waiting     0.200 sec 56.3/120: 47% focus blood_frenzy, potion_of_prolonged_power
1:27.515 default 9 dire_beast Fluffy_Pillow 58.7/120: 49% focus blood_frenzy, potion_of_prolonged_power
1:28.758 default D kill_command Fluffy_Pillow 76.9/120: 64% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:29.768 default E chimaera_shot Fluffy_Pillow 62.3/120: 52% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:31.001 default F cobra_shot Fluffy_Pillow 91.0/120: 76% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:32.235 Waiting     2.500 sec 69.8/120: 58% focus dire_beast, blood_frenzy, potion_of_prolonged_power
1:34.735 default D kill_command Fluffy_Pillow 107.3/120: 89% focus dire_beast, potion_of_prolonged_power
1:36.127 default F cobra_shot Fluffy_Pillow 93.8/120: 78% focus potion_of_prolonged_power
1:37.454 default E chimaera_shot Fluffy_Pillow 68.8/120: 57% focus potion_of_prolonged_power
1:38.781 default 9 dire_beast Fluffy_Pillow 93.8/120: 78% focus potion_of_prolonged_power
1:39.953 default C bestial_wrath Fluffy_Pillow 110.7/120: 92% focus dire_beast, potion_of_prolonged_power
1:39.953 default D kill_command Fluffy_Pillow 110.7/120: 92% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:41.124 default F cobra_shot Fluffy_Pillow 97.4/120: 81% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:42.450 default D kill_command Fluffy_Pillow 76.5/120: 64% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:43.619 default F cobra_shot Fluffy_Pillow 63.2/120: 53% focus bestial_wrath, dire_beast, potion_of_prolonged_power
1:44.946 default D kill_command Fluffy_Pillow 43.4/120: 36% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:45.957 default E chimaera_shot Fluffy_Pillow 28.8/120: 24% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:47.191 default F cobra_shot Fluffy_Pillow 53.8/120: 45% focus bestial_wrath, blood_frenzy, potion_of_prolonged_power
1:48.425 Waiting     0.100 sec 28.9/120: 24% focus bestial_wrath, blood_frenzy, potion_of_prolonged_power
1:48.525 default D kill_command Fluffy_Pillow 30.1/120: 25% focus bestial_wrath, blood_frenzy, potion_of_prolonged_power
1:49.536 default 9 dire_beast Fluffy_Pillow 12.4/120: 10% focus bestial_wrath, blood_frenzy, potion_of_prolonged_power
1:50.549 Waiting     0.900 sec 27.8/120: 23% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:51.449 default D kill_command Fluffy_Pillow 41.5/120: 35% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:52.685 Waiting     0.400 sec 30.3/120: 25% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:53.085 default E chimaera_shot Fluffy_Pillow 36.4/120: 30% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:54.568 default 9 dire_beast Fluffy_Pillow 68.9/120: 57% focus bestial_wrath, dire_beast, blood_frenzy, potion_of_prolonged_power
1:55.580 default D kill_command Fluffy_Pillow 87.3/120: 73% focus dire_beast(2), blood_frenzy, potion_of_prolonged_power
1:56.592 default F cobra_shot Fluffy_Pillow 75.7/120: 63% focus dire_beast(2), blood_frenzy, potion_of_prolonged_power
1:57.825 Waiting     2.700 sec 55.2/120: 46% focus dire_beast, blood_frenzy, potion_of_prolonged_power
2:00.525 default 8 a_murder_of_crows Fluffy_Pillow 96.3/120: 80% focus dire_beast, blood_frenzy
2:01.702 default D kill_command Fluffy_Pillow 84.2/120: 70% focus dire_beast, blood_frenzy
2:02.738 default E chimaera_shot Fluffy_Pillow 67.0/120: 56% focus blood_frenzy
2:03.972 default F cobra_shot Fluffy_Pillow 92.0/120: 77% focus blood_frenzy
2:05.206 default 9 dire_beast Fluffy_Pillow 67.1/120: 56% focus blood_frenzy
2:06.217 default B titans_thunder Fluffy_Pillow 82.4/120: 69% focus dire_beast, blood_frenzy
2:06.217 default D kill_command Fluffy_Pillow 82.4/120: 69% focus dire_beast, blood_frenzy
2:07.228 default F cobra_shot Fluffy_Pillow 67.8/120: 57% focus dire_beast, blood_frenzy
2:08.463 Waiting     1.500 sec 46.6/120: 39% focus dire_beast, blood_frenzy
2:09.963 default E chimaera_shot Fluffy_Pillow 69.4/120: 58% focus dire_beast, blood_frenzy
2:11.349 Waiting     0.800 sec 100.4/120: 84% focus dire_beast, blood_frenzy
2:12.149 default D kill_command Fluffy_Pillow 112.6/120: 94% focus dire_beast, blood_frenzy
2:13.376 default F cobra_shot Fluffy_Pillow 99.2/120: 83% focus blood_frenzy
2:14.611 default F cobra_shot Fluffy_Pillow 73.7/120: 61% focus
2:15.936 default 9 dire_beast Fluffy_Pillow 48.7/120: 41% focus
2:17.102 default C bestial_wrath Fluffy_Pillow 65.5/120: 55% focus dire_beast
2:17.102 default A aspect_of_the_wild Fluffy_Pillow 65.5/120: 55% focus bestial_wrath, dire_beast
2:17.102 default D kill_command Fluffy_Pillow 65.5/120: 55% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:18.273 default E chimaera_shot Fluffy_Pillow 64.0/120: 53% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:19.599 default F cobra_shot Fluffy_Pillow 106.2/120: 89% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:20.925 default D kill_command Fluffy_Pillow 98.5/120: 82% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:22.095 default F cobra_shot Fluffy_Pillow 97.0/120: 81% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:23.421 default D kill_command Fluffy_Pillow 89.2/120: 74% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:24.590 default F cobra_shot Fluffy_Pillow 84.2/120: 70% focus aspect_of_the_wild, bestial_wrath
2:25.915 default D kill_command Fluffy_Pillow 72.5/120: 60% focus aspect_of_the_wild, bestial_wrath
2:27.085 default 9 dire_beast Fluffy_Pillow 67.4/120: 56% focus aspect_of_the_wild, bestial_wrath
2:28.256 default 9 dire_beast Fluffy_Pillow 95.9/120: 80% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:29.424 default D kill_command Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast(2)
2:30.547 default F cobra_shot Fluffy_Pillow 116.8/120: 97% focus bestial_wrath, dire_beast(2), blood_frenzy
2:31.781 default D kill_command Fluffy_Pillow 99.2/120: 83% focus bestial_wrath, dire_beast(2), blood_frenzy
2:32.793 default E chimaera_shot Fluffy_Pillow 87.7/120: 73% focus dire_beast(2), blood_frenzy
2:34.026 default F cobra_shot Fluffy_Pillow 120.0/120: 100% focus dire_beast(2), blood_frenzy
2:35.259 default F cobra_shot Fluffy_Pillow 101.2/120: 84% focus dire_beast, blood_frenzy
2:36.493 Waiting     1.200 sec 77.9/120: 65% focus blood_frenzy
2:37.693 default D kill_command Fluffy_Pillow 92.6/120: 77% focus blood_frenzy
2:38.941 default 9 dire_beast Fluffy_Pillow 77.8/120: 65% focus blood_frenzy
2:39.951 Waiting     0.900 sec 93.1/120: 78% focus dire_beast, blood_frenzy
2:40.851 default D kill_command Fluffy_Pillow 106.8/120: 89% focus dire_beast, blood_frenzy
2:42.089 default F cobra_shot Fluffy_Pillow 95.6/120: 80% focus dire_beast, blood_frenzy
2:43.323 default E chimaera_shot Fluffy_Pillow 73.6/120: 61% focus dire_beast
2:44.650 default F cobra_shot Fluffy_Pillow 102.6/120: 86% focus dire_beast
2:45.978 Waiting     1.400 sec 81.7/120: 68% focus dire_beast
2:47.378 default D kill_command Fluffy_Pillow 100.2/120: 84% focus
2:48.760 default F cobra_shot Fluffy_Pillow 85.9/120: 72% focus
2:50.086 default 9 dire_beast Fluffy_Pillow 60.9/120: 51% focus
2:51.256 default C bestial_wrath Fluffy_Pillow 77.7/120: 65% focus dire_beast
2:51.256 default D kill_command Fluffy_Pillow 77.7/120: 65% focus bestial_wrath, dire_beast
2:52.423 default E chimaera_shot Fluffy_Pillow 64.4/120: 54% focus bestial_wrath, dire_beast
2:53.749 default F cobra_shot Fluffy_Pillow 93.5/120: 78% focus bestial_wrath, dire_beast
2:55.075 default D kill_command Fluffy_Pillow 72.5/120: 60% focus bestial_wrath, dire_beast
2:56.188 default F cobra_shot Fluffy_Pillow 59.1/120: 49% focus bestial_wrath, dire_beast, blood_frenzy
2:57.423 default D kill_command Fluffy_Pillow 37.8/120: 32% focus bestial_wrath, dire_beast, blood_frenzy
2:58.433 Waiting     1.400 sec 21.6/120: 18% focus bestial_wrath, blood_frenzy
2:59.833 default E chimaera_shot Fluffy_Pillow 38.7/120: 32% focus bestial_wrath, blood_frenzy
3:01.246 default 8 a_murder_of_crows Fluffy_Pillow 65.9/120: 55% focus bestial_wrath, blood_frenzy
3:02.258 default 9 dire_beast Fluffy_Pillow 48.2/120: 40% focus bestial_wrath, blood_frenzy
3:03.269 default D kill_command Fluffy_Pillow 63.6/120: 53% focus bestial_wrath, dire_beast, blood_frenzy
3:04.280 default F cobra_shot Fluffy_Pillow 49.0/120: 41% focus bestial_wrath, dire_beast, blood_frenzy
3:05.514 Waiting     0.200 sec 27.7/120: 23% focus bestial_wrath, dire_beast
3:05.714 default D kill_command Fluffy_Pillow 30.5/120: 25% focus bestial_wrath, dire_beast
3:06.884 default B titans_thunder Fluffy_Pillow 17.3/120: 14% focus dire_beast
3:06.884 Waiting     0.500 sec 17.3/120: 14% focus dire_beast
3:07.384 default E chimaera_shot Fluffy_Pillow 24.5/120: 20% focus dire_beast
3:08.866 Waiting     3.300 sec 55.7/120: 46% focus dire_beast
3:12.166 default D kill_command Fluffy_Pillow 97.4/120: 81% focus
3:13.499 default 9 dire_beast Fluffy_Pillow 82.5/120: 69% focus
3:14.669 Waiting     1.100 sec 99.2/120: 83% focus dire_beast
3:15.769 default D kill_command Fluffy_Pillow 115.0/120: 96% focus dire_beast
3:16.945 default F cobra_shot Fluffy_Pillow 102.8/120: 86% focus dire_beast, blood_frenzy
3:18.179 default E chimaera_shot Fluffy_Pillow 81.6/120: 68% focus dire_beast, blood_frenzy
3:19.412 default F cobra_shot Fluffy_Pillow 110.3/120: 92% focus dire_beast, blood_frenzy
3:20.644 Waiting     1.200 sec 89.0/120: 74% focus dire_beast, blood_frenzy
3:21.844 default D kill_command Fluffy_Pillow 106.1/120: 88% focus blood_frenzy
3:23.094 default F cobra_shot Fluffy_Pillow 91.3/120: 76% focus blood_frenzy
3:24.328 default 9 dire_beast Fluffy_Pillow 66.4/120: 55% focus blood_frenzy
3:25.342 default D kill_command Fluffy_Pillow 81.8/120: 68% focus dire_beast, blood_frenzy
3:26.392 default E chimaera_shot Fluffy_Pillow 67.3/120: 56% focus dire_beast
3:27.718 default F cobra_shot Fluffy_Pillow 96.3/120: 80% focus dire_beast
3:29.045 Waiting     2.700 sec 75.3/120: 63% focus dire_beast
3:31.745 default D kill_command Fluffy_Pillow 114.0/120: 95% focus dire_beast
3:33.088 default F cobra_shot Fluffy_Pillow 99.8/120: 83% focus
3:34.414 default E chimaera_shot Fluffy_Pillow 74.8/120: 62% focus
3:35.739 Waiting     0.300 sec 99.8/120: 83% focus
3:36.039 default C bestial_wrath Fluffy_Pillow 103.2/120: 86% focus
3:36.256 default 9 dire_beast Fluffy_Pillow 105.7/120: 88% focus bestial_wrath, blood_frenzy
3:37.267 default D kill_command Fluffy_Pillow 120.0/120: 100% focus bestial_wrath, dire_beast, blood_frenzy
3:38.279 default F cobra_shot Fluffy_Pillow 105.4/120: 88% focus bestial_wrath, dire_beast, blood_frenzy
3:39.513 default D kill_command Fluffy_Pillow 84.1/120: 70% focus bestial_wrath, dire_beast, blood_frenzy
3:40.525 default F cobra_shot Fluffy_Pillow 69.5/120: 58% focus bestial_wrath, dire_beast, blood_frenzy
3:41.758 default D kill_command Fluffy_Pillow 48.3/120: 40% focus bestial_wrath, dire_beast, blood_frenzy
3:42.769 default E chimaera_shot Fluffy_Pillow 33.6/120: 28% focus bestial_wrath, dire_beast, blood_frenzy
3:44.002 default F cobra_shot Fluffy_Pillow 62.4/120: 52% focus bestial_wrath, dire_beast, blood_frenzy
3:45.234 default D kill_command Fluffy_Pillow 37.4/120: 31% focus bestial_wrath, blood_frenzy
3:46.244 default 9 dire_beast Fluffy_Pillow 19.7/120: 16% focus bestial_wrath, blood_frenzy
3:47.254 Waiting     0.900 sec 35.1/120: 29% focus bestial_wrath, dire_beast, blood_frenzy
3:48.154 default D kill_command Fluffy_Pillow 48.7/120: 41% focus bestial_wrath, dire_beast, blood_frenzy
3:49.395 Waiting     0.200 sec 37.6/120: 31% focus bestial_wrath, dire_beast, blood_frenzy
3:49.595 default F cobra_shot Fluffy_Pillow 40.6/120: 34% focus bestial_wrath, dire_beast, blood_frenzy
3:50.831 default E chimaera_shot Fluffy_Pillow 19.4/120: 16% focus bestial_wrath, dire_beast, blood_frenzy
3:52.065 default D kill_command Fluffy_Pillow 48.2/120: 40% focus dire_beast, blood_frenzy
3:53.075 Waiting     2.800 sec 33.5/120: 28% focus dire_beast, blood_frenzy
3:55.875 default 9 dire_beast Fluffy_Pillow 71.0/120: 59% focus blood_frenzy
3:57.095 default D kill_command Fluffy_Pillow 88.9/120: 74% focus dire_beast, blood_frenzy
3:58.107 default E chimaera_shot Fluffy_Pillow 74.3/120: 62% focus dire_beast, blood_frenzy
3:59.442 default 9 dire_beast Fluffy_Pillow 104.6/120: 87% focus dire_beast, blood_frenzy
4:00.454 default D kill_command Fluffy_Pillow 120.0/120: 100% focus dire_beast(2), blood_frenzy
4:01.514 default 8 a_murder_of_crows Fluffy_Pillow 108.7/120: 91% focus dire_beast(2)
4:02.684 default F cobra_shot Fluffy_Pillow 99.0/120: 82% focus dire_beast(2)
4:04.011 Waiting     2.000 sec 82.0/120: 68% focus dire_beast(2)
4:06.011 default C bestial_wrath Fluffy_Pillow 111.0/120: 92% focus dire_beast
4:06.256 default F cobra_shot Fluffy_Pillow 114.5/120: 95% focus bestial_wrath, dire_beast
4:07.581 default D kill_command Fluffy_Pillow 90.3/120: 75% focus bestial_wrath
4:08.750 default E chimaera_shot Fluffy_Pillow 73.5/120: 61% focus bestial_wrath
4:10.076 default 9 dire_beast Fluffy_Pillow 98.6/120: 82% focus bestial_wrath
4:11.245 default B titans_thunder Fluffy_Pillow 115.3/120: 96% focus bestial_wrath, dire_beast
4:11.245 default D kill_command Fluffy_Pillow 115.3/120: 96% focus bestial_wrath, dire_beast
4:12.415 default F cobra_shot Fluffy_Pillow 102.1/120: 85% focus bestial_wrath, dire_beast
4:13.742 default D kill_command Fluffy_Pillow 81.1/120: 68% focus bestial_wrath, dire_beast
4:14.912 default F cobra_shot Fluffy_Pillow 67.9/120: 57% focus bestial_wrath, dire_beast
4:16.239 default D kill_command Fluffy_Pillow 46.9/120: 39% focus bestial_wrath, dire_beast
4:17.408 default A aspect_of_the_wild Fluffy_Pillow 33.7/120: 28% focus bestial_wrath, dire_beast
4:17.408 default E chimaera_shot Fluffy_Pillow 33.7/120: 28% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:18.735 default F cobra_shot Fluffy_Pillow 72.0/120: 60% focus aspect_of_the_wild, bestial_wrath
4:20.061 default D kill_command Fluffy_Pillow 60.3/120: 50% focus aspect_of_the_wild, bestial_wrath
4:21.230 default 9 dire_beast Fluffy_Pillow 55.3/120: 46% focus aspect_of_the_wild, bestial_wrath
4:22.369 Waiting     1.000 sec 83.3/120: 69% focus aspect_of_the_wild, dire_beast, blood_frenzy
4:23.369 default D kill_command Fluffy_Pillow 108.5/120: 90% focus aspect_of_the_wild, dire_beast, blood_frenzy
4:24.569 default F cobra_shot Fluffy_Pillow 108.8/120: 91% focus aspect_of_the_wild, dire_beast, blood_frenzy
4:25.802 default F cobra_shot Fluffy_Pillow 99.8/120: 83% focus aspect_of_the_wild, dire_beast, blood_frenzy
4:27.034 default F cobra_shot Fluffy_Pillow 90.9/120: 76% focus aspect_of_the_wild, dire_beast, blood_frenzy
4:28.267 default E chimaera_shot Fluffy_Pillow 81.9/120: 68% focus aspect_of_the_wild, dire_beast, blood_frenzy
4:29.499 default D kill_command Fluffy_Pillow 119.3/120: 99% focus aspect_of_the_wild, blood_frenzy
4:30.715 default F cobra_shot Fluffy_Pillow 109.4/120: 91% focus blood_frenzy
4:31.950 default 9 dire_beast Fluffy_Pillow 84.4/120: 70% focus blood_frenzy
4:33.033 default D kill_command Fluffy_Pillow 100.0/120: 83% focus dire_beast
4:34.200 default F cobra_shot Fluffy_Pillow 86.7/120: 72% focus dire_beast
4:35.527 Waiting     0.100 sec 66.9/120: 56% focus dire_beast, blood_frenzy
4:35.627 default E chimaera_shot Fluffy_Pillow 68.4/120: 57% focus dire_beast, blood_frenzy
4:37.031 default F cobra_shot Fluffy_Pillow 99.8/120: 83% focus dire_beast, blood_frenzy
4:38.264 Waiting     0.800 sec 78.5/120: 65% focus dire_beast, blood_frenzy
4:39.064 default D kill_command Fluffy_Pillow 90.7/120: 76% focus dire_beast, blood_frenzy
4:40.274 default F cobra_shot Fluffy_Pillow 76.3/120: 64% focus blood_frenzy
4:41.508 Waiting     0.200 sec 51.4/120: 43% focus blood_frenzy
4:41.708 default 9 dire_beast Fluffy_Pillow 53.8/120: 45% focus blood_frenzy
4:42.953 default C bestial_wrath Fluffy_Pillow 72.0/120: 60% focus dire_beast, blood_frenzy
4:42.953 default D kill_command Fluffy_Pillow 72.0/120: 60% focus bestial_wrath, dire_beast, blood_frenzy
4:43.965 default E chimaera_shot Fluffy_Pillow 57.4/120: 48% focus bestial_wrath, dire_beast, blood_frenzy
4:45.199 default F cobra_shot Fluffy_Pillow 85.3/120: 71% focus bestial_wrath, dire_beast
4:46.527 default D kill_command Fluffy_Pillow 64.3/120: 54% focus bestial_wrath, dire_beast
4:47.698 default F cobra_shot Fluffy_Pillow 51.1/120: 43% focus bestial_wrath, dire_beast
4:49.025 default D kill_command Fluffy_Pillow 30.2/120: 25% focus bestial_wrath, dire_beast
4:50.150 Waiting     1.400 sec 15.0/120: 13% focus bestial_wrath, blood_frenzy
4:51.550 default E chimaera_shot Fluffy_Pillow 32.1/120: 27% focus bestial_wrath, blood_frenzy
4:52.952 default 9 dire_beast Fluffy_Pillow 59.2/120: 49% focus bestial_wrath, blood_frenzy
4:53.963 default D kill_command Fluffy_Pillow 74.6/120: 62% focus bestial_wrath, dire_beast, blood_frenzy
4:54.974 default F cobra_shot Fluffy_Pillow 60.0/120: 50% focus bestial_wrath, dire_beast, blood_frenzy
4:56.207 default D kill_command Fluffy_Pillow 38.7/120: 32% focus bestial_wrath, dire_beast, blood_frenzy
4:57.219 Waiting     1.700 sec 24.1/120: 20% focus bestial_wrath, dire_beast, blood_frenzy
4:58.919 default E chimaera_shot Fluffy_Pillow 49.9/120: 42% focus dire_beast, blood_frenzy
5:00.332 Waiting     1.000 sec 80.7/120: 67% focus dire_beast
5:01.332 default 8 a_murder_of_crows Fluffy_Pillow 93.9/120: 78% focus
5:02.683 default D kill_command Fluffy_Pillow 79.2/120: 66% focus

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 30471 29106 18689 (12641)
Stamina 45618 45618 27284
Intellect 6002 6002 0
Spirit -1 -1 0
Health 2737080 2737080 0
Focus 120 120 0
Crit 24.23% 24.23% 5292
Haste 13.39% 13.39% 5021
Damage / Heal Versatility 2.16% 2.16% 1027
Attack Power 30471 29106 0
Mastery 80.26% 78.17% 10695
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Greyed Dragonscale Coif
ilevel: 885, stats: { 375 Armor, +2829 Sta, +1886 AgiInt, +881 Mastery, +680 Crit }
Local Neck Intrepid Necklace of Prophecy of the Feverflare
ilevel: 865, stats: { +1321 Sta, +812 Haste, +1558 Mastery }, gems: { +150 Mastery }, enchant: { +600 Mastery }
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 870, stats: { 330 Armor, +1846 Sta, +1231 AgiInt, +744 Mastery, +364 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2701 Sta, +1801 AgiInt, +997 Crit, +536 Mastery }
Local Waist Emblazoned Duskwatch Belt
ilevel: 885, stats: { 260 Armor, +2123 Sta, +1415 AgiInt, +686 Haste, +485 Mastery }
Local Legs Legguards of Countless Hours
ilevel: 865, stats: { 379 Armor, +1566 AgiInt, +2349 Sta, +849 Mastery, +600 Vers }, gems: { +200 Agi }
Local Feet Qa'pla, Eredun War Order
ilevel: 910, stats: { 343 Armor, +2680 Sta, +1786 Agi, +551 Crit, +735 Mastery }
Local Wrists Bite-Resistant Wristclamps
ilevel: 875, stats: { 196 Armor, +1450 Sta, +967 AgiInt, +496 Mastery, +350 Haste }
Local Hands Gauntlets of Malevolent Intent
ilevel: 865, stats: { 271 Armor, +1761 Sta, +1174 AgiInt, +660 Haste, +427 Vers }, gems: { +150 Mastery }
Local Finger1 Shadowruby Band of the Feverflare
ilevel: 865, stats: { +1321 Sta, +1694 Mastery, +677 Haste }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Sephuz's Secret
ilevel: 910, stats: { +2010 Sta, +890 Haste, +2227 Crit }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 865, stats: { +1489 AgiInt }
Local Trinket2 Bloodthirsty Instinct
ilevel: 880, stats: { +1712 Agi }
Local Back Drape of the Unworthy
ilevel: 890, stats: { 150 Armor, +1112 StrAgiInt, +1668 Sta, +582 Haste, +313 Mastery }, enchant: { +200 Agi }
Local Main Hand Titanstrike
ilevel: 899, weapon: { 11037 - 11038, 3 }, stats: { +2150 Agi, +3225 Sta, +837 Crit, +804 Mastery }, relics: { +49 ilevels, +48 ilevels, +52 ilevels }

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Trailblazer
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Rinotor"
origin="https://eu.api.battle.net/wow/character/hyjal/Rinotor/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/211/115093459-avatar.jpg"
level=110
race=worgen
role=attack
position=ranged_back
professions=jewelcrafting=781/mining=610
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!2202201
artifact=56:0:0:0:0:868:3:869:3:870:3:871:3:872:3:873:3:874:3:875:3:876:1:877:1:878:1:879:1:880:1:881:1:882:1:1095:3:1336:1:1368:8
spec=beast_mastery

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/berserking
actions+=/blood_fury
actions+=/volley,toggle=on
actions+=/potion,name=prolonged_power,if=buff.bestial_wrath.remains|!cooldown.beastial_wrath.remains
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>3
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>6|target.time_to_die<9
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up|target.time_to_die<12
actions+=/barrage,if=spell_targets.barrage>1
actions+=/titans_thunder,if=talent.dire_frenzy.enabled|cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=cooldown.kill_command.remains>focus.time_to_max&cooldown.bestial_wrath.remains>focus.time_to_max|(buff.bestial_wrath.up&focus.regen*cooldown.kill_command.remains>30)|target.time_to_die<cooldown.kill_command.remains

head=greyed_dragonscale_coif,id=139214,bonus_id=1806/1507/3336
neck=intrepid_necklace_of_prophecy,id=130240,bonus_id=1768/689/601/672,gems=150mastery,enchant=600mastery
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1805/1492/3336
back=drape_of_the_unworthy,id=142521,bonus_id=3507/1507/3336,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806/1502
wrists=biteresistant_wristclamps,id=142423,bonus_id=3468/1492
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1805/1808/1487,gems=150mastery
waist=emblazoned_duskwatch_belt,id=140868,bonus_id=3514/1482/3336
legs=legguards_of_countless_hours,id=142135,bonus_id=1808/3453/1477/3336,gems=200agi
feet=qapla_eredun_war_order,id=137227,bonus_id=1811
finger1=shadowruby_band,id=136713,bonus_id=3355/689/601/672,gems=150mastery,enchant=200mastery
finger2=sephuzs_secret,id=132452,bonus_id=3459/3458,gems=150mastery,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1805/1487
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1806/1502
main_hand=titanstrike,id=128861,bonus_id=726,gem_id=137270/139269/139261/0,relic_id=3415:1522:3337/1805:1487/1806:1502/0

# Gear Summary
# gear_ilvl=880.60
# gear_agility=18689
# gear_stamina=27284
# gear_crit_rating=5292
# gear_haste_rating=5021
# gear_mastery_rating=10695
# gear_versatility_rating=1027
# gear_armor=2758
summon_pet=cat

Eldiablø

Eldiablø : 331071 dps

  • Race: Human
  • Class: Mage
  • Spec: Arcane
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
331070.7 331070.7 295.8 / 0.089% 59121.1 / 17.9% 8.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
36950.9 36950.9 Mana 0.48% 39.4 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Eldiablø/advanced
Talents
  • 15: Amplification (Arcane Mage)
  • 30: Slipstream (Arcane Mage)
  • 45: Rune of Power
  • 60: Resonance (Arcane Mage)
  • 75: Ice Ward
  • 90: Unstable Magic
  • 100: Overpowered
  • Talent Calculator
Artifact
Professions
  • herbalism: 39
  • inscription: 314

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Eldiablø 331071
Aegwynn's Ascendance 3561 1.1% 3.4 93.84sec 315528 0 Direct 3.4 315526 0 315526 0.0%  

Stats details: aegwynns_ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.39 3.39 0.00 0.00 0.0000 0.0000 1069147.87 1069147.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.39 100.00% 315526.39 86215 344845 315783.64 221828 335464 1069148 1069148 0.00
 
 

Action details: aegwynns_ascendance

Static Values
  • id:187677
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187677
  • name:Aegwynn's Ascendance
  • school:arcane
  • tooltip:
  • description:An emanation of mana-fueled Arcane damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:327818.62
  • base_dd_max:327818.62
 
Arcane Barrage 15984 4.9% 14.0 18.62sec 344438 279000 Direct 13.9 267730 535477 346610 29.5%  

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.91 0.00 0.00 1.2346 0.0000 4819717.08 4819717.08 0.00 278999.54 278999.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.81 70.54% 267729.65 113211 609722 268028.85 208527 432954 2626326 2626326 0.00
crit 4.10 29.46% 535476.53 226422 1219444 529406.63 0 1219444 2193391 2193391 0.00
 
 

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:5500.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(equipped.132451&cooldown.charged_up.remains=0&mana.pct<(100-(buff.arcane_charge.stack*0.03)))
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 130.0%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge$?a231564[ Hits {$36032s3=0} additional $Ltarget:targets; within {$s3=10} yds per Arcane Charge for {$s2=50}% damage.][] |cFFFFFFFFConsumes all Arcane Charges.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Blast 144189 43.6% 99.8 3.01sec 433927 248716 Direct 100.8 332353 663422 429620 29.4%  

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.77 100.77 0.00 0.00 1.7447 0.0000 43291091.99 43291091.99 0.00 248716.47 248716.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.16 70.62% 332352.64 79873 742920 332700.02 256214 412252 23650925 23650925 0.00
crit 29.60 29.38% 663422.43 159747 1485840 664266.63 342367 1010300 19640167 19640167 0.00
 
 

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 192.4%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s5=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.924000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Arcane Missiles 109302 33.1% 39.7 7.29sec 827837 452640 Periodic 236.8 107229 214441 138806 29.5% 20.8%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.70 0.00 237.73 236.75 1.8289 0.2634 32862132.04 32862132.04 0.00 452640.21 452640.21
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 167.0 70.55% 107228.70 18392 197332 107228.32 88547 131912 17908941 17908941 0.00
crit 69.7 29.45% 214440.76 36784 394665 214390.78 172740 274467 14953191 14953191 0.00
 
 

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_missiles.react=3
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s2=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s2=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.443000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Collapse 2148 0.6% 7.5 33.75sec 85398 0 Direct 7.5 65920 131459 85402 29.7%  

Stats details: collapse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 0.0000 0.0000 642807.48 642807.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.29 70.28% 65920.14 40000 95200 66281.45 0 95200 348722 348722 0.00
crit 2.24 29.72% 131459.27 80000 190400 116570.78 0 190400 294086 294086 0.00
 
 

Action details: collapse

Static Values
  • id:234142
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234142
  • name:Collapse
  • school:shadow
  • tooltip:
  • description:Deal {$s1=40000} Shadow damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:40000.00
  • base_dd_max:40000.00
 
Deadly Grace 14513 4.3% 23.1 5.67sec 186020 0 Direct 23.1 143780 287673 186021 29.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.08 23.08 0.00 0.00 0.0000 0.0000 4293130.75 4293130.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.30 70.65% 143779.57 83132 197853 143679.08 102344 185621 2344261 2344261 0.00
crit 6.77 29.35% 287672.71 166263 395707 287436.04 0 395707 1948870 1948870 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of Aluneth 8818 2.7% 5.2 62.55sec 507071 321288 Periodic 30.8 65992 131803 85458 29.6% 10.3%

Stats details: mark_of_aluneth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.20 0.00 30.85 30.85 1.5784 1.0000 2636169.20 2636169.20 0.00 67502.35 321288.14
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.7 70.42% 65992.21 41962 99869 66468.46 50648 85182 1433505 1433505 0.00
crit 9.1 29.58% 131803.41 83924 199738 132757.62 83924 199738 1202664 1202664 0.00
 
 

Action details: mark_of_aluneth

Static Values
  • id:224968
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.arcane_power.remains>20
Spelldata
  • id:224968
  • name:Mark of Aluneth
  • school:arcane
  • tooltip:Deals continuous Arcane damage, and then detonates for massive damage to nearby enemies.
  • description:Creates a rune around the target, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mark of Aluneth (_explosion) 8029 2.4% 5.2 62.48sec 461594 0 Direct 5.2 357528 714270 461575 29.2%  

Stats details: mark_of_aluneth_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.20 5.20 0.00 0.00 0.0000 0.0000 2399743.90 2399743.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.68 70.83% 357527.75 217263 517086 359492.44 0 517086 1316411 1316411 0.00
crit 1.52 29.17% 714269.98 434526 1034171 595197.69 0 1034171 1083333 1083333 0.00
 
 

Action details: mark_of_aluneth_explosion

Static Values
  • id:210726
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210726
  • name:Mark of Aluneth
  • school:physical
  • tooltip:
  • description:Creates a runic prison at the target's location, slowing enemy movement speed by ${{$211056s1=70}/-1}%, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206916.60
  • base_dd_max:206916.60
 
Touch of the Magi 10111 3.1% 8.6 32.82sec 351592 0 Direct 8.6 353907 0 353907 0.0%  

Stats details: touch_of_the_magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.62 8.57 0.00 0.00 0.0000 0.0000 3031803.42 3031803.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.57 100.00% 353907.42 8000 2254795 355876.21 0 964061 3031803 3031803 0.00
 
 

Action details: touch_of_the_magi

Static Values
  • id:210833
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating {$s1=20}% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:198125.89
  • base_dd_max:198125.89
 
Unstable Magic (_explosion) 14415 4.4% 20.0 14.56sec 216687 0 Direct 20.2 214514 0 214514 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.96 20.16 0.00 0.00 0.0000 0.0000 4324807.94 4324807.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.16 100.00% 214514.23 39937 742920 214931.72 102122 400261 4324808 4324808 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=20}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:79873.30
  • base_dd_max:79873.30
 
Simple Action Stats Execute Interval
Eldiablø
Arcane Power 3.6 93.31sec

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiablø
  • harmful:false
  • if_expr:
 
Evocation 3.4 93.43sec

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.39 0.00 13.48 0.00 4.8378 1.1532 0.00 0.00 0.00 0.00 0.00
 
 

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana every $t1 sec.
  • description:Returns ${4*$m1}% of your total mana over {$d=6 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiablø
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiablø
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Presence of Mind 3.8 89.36sec

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: presence_of_mind

Static Values
  • id:205025
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.rune_of_power.remains<=2*action.arcane_blast.execute_time
Spelldata
  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
 
Rune of Power 8.8 35.25sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.75 0.00 0.00 0.00 1.1744 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct>45&buff.arcane_power.down
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Charge 14.8 125.7 20.5sec 2.2sec 85.82% 85.37% 83.9(83.9) 0.0

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_charge_1:9.41%
  • arcane_charge_2:10.09%
  • arcane_charge_3:9.60%
  • arcane_charge_4:56.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Missiles! 23.0 18.0 13.1sec 7.3sec 44.73% 44.73% 0.5(0.5) 0.0

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_arcane_missiles
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_missiles_1:32.66%
  • arcane_missiles_2:10.84%
  • arcane_missiles_3:1.23%

Trigger Attempt Success

  • trigger_pct:35.89%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to {$79683s1=3} charges and lasts {$79683d=20 seconds}.
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 93.3sec 93.3sec 16.56% 100.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:14.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_power_1:16.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 22.68% 0.0(0.0) 1.0

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 98.6sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Presence of Mind 3.8 0.0 89.3sec 89.3sec 3.50% 7.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_presence_of_mind
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • presence_of_mind_1:2.62%
  • presence_of_mind_2:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.3sec 35.3sec 28.75% 28.75% 0.0(0.0) 8.5

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Temptation 3.0 4.5 94.2sec 34.0sec 51.08% 58.74% 0.0(0.0) 2.4

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_temptation
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • temptation_1:15.89%
  • temptation_2:24.73%
  • temptation_3:8.62%
  • temptation_4:1.46%
  • temptation_5:0.40%
  • temptation_6:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:234143
  • name:Temptation
  • tooltip:Increased chance for your Ring of Collapsing Futures to incur a {$s1=5} min cooldown.
  • description:{$@spelldesc234142=Deal {$s1=40000} Shadow damage to an enemy.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Eldiablø
arcane_barrage Mana 14.0 76038.4 5433.9 5434.0 63.4
arcane_blast Mana 100.8 11075274.0 109910.3 111012.8 3.9
Resource Gains Type Count Total Average Overflow
arcane_blast None 100.77 0.00 (0.00%) 0.00 100.77 100.00%
evocation Mana 13.48 4276175.59 (42.59%) 317325.71 371056.42 7.98%
mp5_regen Mana 548.22 5763136.81 (57.41%) 10512.49 451751.16 7.27%
Resource RPS-Gain RPS-Loss
Mana 33373.54 36950.93
Combat End Resource Mean Min Max
Mana 302857.53 103.46 1379444.00

Benefits & Uptimes

Benefits %
Arcane Barrage Arcane Charge 1 0.6%
Arcane Barrage Arcane Charge 2 3.7%
Arcane Barrage Arcane Charge 3 4.2%
Arcane Barrage Arcane Charge 4 91.5%
Arcane Blast Arcane Charge 0 14.6%
Arcane Blast Arcane Charge 1 14.3%
Arcane Blast Arcane Charge 2 12.7%
Arcane Blast Arcane Charge 3 11.7%
Arcane Blast Arcane Charge 4 46.7%
Arcane Missiles Arcane Charge 0 0.0%
Arcane Missiles Arcane Charge 1 0.4%
Arcane Missiles Arcane Charge 2 2.7%
Arcane Missiles Arcane Charge 3 3.7%
Arcane Missiles Arcane Charge 4 93.1%
Arcane Missiles! from Arcane Blast 93.5%
Arcane Missiles! from Arcane Barrage 6.5%
Uptimes %
Mana Cap 2.7%

Statistics & Data Analysis

Fight Length
Sample Data Eldiablø Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Eldiablø Damage Per Second
Count 9999
Mean 331070.73
Minimum 277321.05
Maximum 387873.57
Spread ( max - min ) 110552.52
Range [ ( max - min ) / 2 * 100% ] 16.70%
Standard Deviation 15092.7957
5th Percentile 306884.55
95th Percentile 356355.16
( 95th Percentile - 5th Percentile ) 49470.61
Mean Distribution
Standard Deviation 150.9355
95.00% Confidence Intervall ( 330774.90 - 331366.56 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7984
0.1 Scale Factor Error with Delta=300 1944568
0.05 Scale Factor Error with Delta=300 7778271
0.01 Scale Factor Error with Delta=300 194456764
Priority Target DPS
Sample Data Eldiablø Priority Target Damage Per Second
Count 9999
Mean 331070.73
Minimum 277321.05
Maximum 387873.57
Spread ( max - min ) 110552.52
Range [ ( max - min ) / 2 * 100% ] 16.70%
Standard Deviation 15092.7957
5th Percentile 306884.55
95th Percentile 356355.16
( 95th Percentile - 5th Percentile ) 49470.61
Mean Distribution
Standard Deviation 150.9355
95.00% Confidence Intervall ( 330774.90 - 331366.56 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7984
0.1 Scale Factor Error with Delta=300 1944568
0.05 Scale Factor Error with Delta=300 7778271
0.01 Scale Factor Error with Delta=300 194456764
DPS(e)
Sample Data Eldiablø Damage Per Second (Effective)
Count 9999
Mean 331070.73
Minimum 277321.05
Maximum 387873.57
Spread ( max - min ) 110552.52
Range [ ( max - min ) / 2 * 100% ] 16.70%
Damage
Sample Data Eldiablø Damage
Count 9999
Mean 99370551.67
Minimum 70474962.26
Maximum 133297985.37
Spread ( max - min ) 62823023.10
Range [ ( max - min ) / 2 * 100% ] 31.61%
DTPS
Sample Data Eldiablø Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Eldiablø Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Eldiablø Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Eldiablø Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Eldiablø Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Eldiablø Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EldiabløTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Eldiablø Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 summon_arcane_familiar
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 arcane_blast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(buff.bloodlust.down)&((time=0)|(equipped.132410&buff.arcane_power.up&prev_off_gcd.arcane_power)|(target.time_to_die<40))
0.00 mirror_image,if=buff.arcane_power.down
8 3.35 stop_burn_phase,if=prev_gcd.1.evocation&burn_phase_duration>gcd.max
9 3.24 mark_of_aluneth,if=cooldown.arcane_power.remains>20
A 0.00 call_action_list,name=build,if=buff.arcane_charge.stack<4
B 0.00 call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
C 0.00 call_action_list,name=burn,if=burn_phase
D 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
E 0.00 call_action_list,name=conserve
actions.build
# count action,conditions
0.00 charged_up,if=buff.arcane_charge.stack<=1
F 0.34 arcane_missiles,if=buff.arcane_missiles.react=3
0.00 arcane_orb
0.00 arcane_explosion,if=active_enemies>1
G 53.19 arcane_blast
actions.burn
# count action,conditions
H 0.00 call_action_list,name=cooldowns
0.00 charged_up,if=(equipped.132451&buff.arcane_charge.stack<=1)
I 0.72 arcane_missiles,if=buff.arcane_missiles.react=3
0.00 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
J 1.71 arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
0.00 arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
K 3.81 presence_of_mind,if=buff.rune_of_power.remains<=2*action.arcane_blast.execute_time
L 8.03 arcane_missiles,if=buff.arcane_missiles.react>1
0.00 arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
M 22.64 arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
0.00 supernova,if=mana.pct<100
N 8.29 arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
0.00 arcane_explosion,if=active_enemies>1
0.00 arcane_barrage,if=(equipped.132451&cooldown.charged_up.remains=0&mana.pct<(100-(buff.arcane_charge.stack*0.03)))
O 14.15 arcane_blast
P 3.39 evocation,interrupt_if=mana.pct>99
actions.conserve
# count action,conditions
Q 0.62 arcane_missiles,if=buff.arcane_missiles.react=3
R 1.22 arcane_blast,if=mana.pct>99
0.00 nether_tempest,if=(refreshable|!ticking)
0.00 arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
S 17.24 arcane_missiles
0.00 supernova,if=mana.pct<100
0.00 arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
0.00 arcane_blast,if=mana.pct>=82&equipped.132451
T 13.15 arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
0.00 arcane_explosion,if=active_enemies>1
U 1.45 arcane_blast
actions.cooldowns
# count action,conditions
V 0.05 rune_of_power,if=mana.pct>45&buff.arcane_power.down
W 3.61 arcane_power
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
X 7.53 use_item,slot=finger1
Y 2.67 use_item,slot=trinket2
Z 1.00 potion,name=deadly_grace,if=buff.arcane_power.up
actions.init_burn
# count action,conditions
a 1.98 mark_of_aluneth
0.00 nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.1.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
b 8.74 rune_of_power
c 4.32 start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55
actions.rop_phase
# count action,conditions
d 0.21 arcane_missiles,if=buff.arcane_missiles.react=3
0.00 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
e 4.24 arcane_missiles,if=buff.arcane_charge.stack=4
0.00 arcane_explosion,if=active_enemies>1
f 5.95 arcane_blast,if=mana.pct>45
g 0.84 arcane_barrage

Sample Sequence

01267GGGabcWXYMMLMMKMMLMMNbXOONOOONOP8RSTGGGGTGGGGSSTG9GGGbeffgGGGGSSUbcWXZMMMMKMLMMOXSTGGSTGGYP89GGbeeffefTGGGGSSSTGGGGTGGGGSSUSUabcWXMMMMKMMLMObXSTGGP8GGSSTGGGGSSSTGGGG9SbcXYOOONKMMNOTGGXTGGSWGbMMMXLMOSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Eldiablø 1379444.0/1379444: 100% mana
Pre precombat 1 food Eldiablø 1379444.0/1379444: 100% mana
Pre precombat 2 augmentation Eldiablø 1379444.0/1379444: 100% mana
Pre precombat 6 potion Fluffy_Pillow 1379444.0/1379444: 100% mana potion_of_deadly_grace
0:00.000 precombat 7 arcane_blast Fluffy_Pillow 1346444.0/1379444: 98% mana potion_of_deadly_grace
0:00.000 build G arcane_blast Fluffy_Pillow 1346444.0/1379444: 98% mana potion_of_deadly_grace
0:01.856 build G arcane_blast Fluffy_Pillow 1305256.1/1379444: 95% mana bloodlust, potion_of_deadly_grace
0:03.288 build G arcane_blast Fluffy_Pillow 1219386.5/1379444: 88% mana bloodlust, potion_of_deadly_grace
0:04.718 init_burn a mark_of_aluneth Fluffy_Pillow 1092225.6/1379444: 79% mana bloodlust, arcane_missiles, potion_of_deadly_grace
0:05.990 init_burn b rune_of_power Fluffy_Pillow 1118545.4/1379444: 81% mana bloodlust, arcane_missiles, potion_of_deadly_grace
0:06.945 init_burn c start_burn_phase Fluffy_Pillow 1138305.9/1379444: 83% mana bloodlust, arcane_missiles, rune_of_power, potion_of_deadly_grace
0:06.945 cooldowns W arcane_power Fluffy_Pillow 1138305.9/1379444: 83% mana bloodlust, arcane_missiles, rune_of_power, potion_of_deadly_grace
0:06.945 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 1138305.9/1379444: 83% mana bloodlust, arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
0:06.945 cooldowns Y use_item_figurehead_of_the_naglfar Fluffy_Pillow 1138305.9/1379444: 83% mana bloodlust, temptation, arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
0:06.945 burn M arcane_blast Fluffy_Pillow 1138305.9/1379444: 83% mana bloodlust, temptation, arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
0:08.374 burn M arcane_blast Fluffy_Pillow 1108474.3/1379444: 80% mana bloodlust, temptation, arcane_missiles(2), arcane_power, rune_of_power, potion_of_deadly_grace
0:09.806 burn L arcane_missiles Fluffy_Pillow 1078704.8/1379444: 78% mana bloodlust, temptation, arcane_missiles(2), arcane_power, rune_of_power, potion_of_deadly_grace
0:11.292 burn M arcane_blast Fluffy_Pillow 1109452.6/1379444: 80% mana bloodlust, temptation, arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
0:12.722 burn M arcane_blast Fluffy_Pillow 1079641.7/1379444: 78% mana bloodlust, temptation, arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
0:14.152 burn K presence_of_mind Fluffy_Pillow 1049830.7/1379444: 76% mana bloodlust, temptation, arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
0:14.152 burn M arcane_blast Fluffy_Pillow 1049830.7/1379444: 76% mana bloodlust, temptation, arcane_missiles, arcane_power, presence_of_mind(2), rune_of_power, potion_of_deadly_grace
0:15.106 burn M arcane_blast Fluffy_Pillow 1010170.6/1379444: 73% mana bloodlust, temptation, arcane_missiles(2), arcane_power, presence_of_mind, rune_of_power, potion_of_deadly_grace
0:16.060 burn L arcane_missiles Fluffy_Pillow 970510.4/1379444: 70% mana bloodlust, temptation, arcane_missiles(2), arcane_power, rune_of_power, potion_of_deadly_grace
0:17.622 burn M arcane_blast Fluffy_Pillow 1002830.8/1379444: 73% mana bloodlust, temptation, arcane_missiles, arcane_power, potion_of_deadly_grace
0:19.051 burn M arcane_blast Fluffy_Pillow 972999.2/1379444: 71% mana bloodlust, temptation, arcane_missiles, arcane_power, potion_of_deadly_grace
0:20.480 burn N arcane_missiles Fluffy_Pillow 943167.6/1379444: 68% mana bloodlust, temptation, arcane_missiles, arcane_power, potion_of_deadly_grace
0:21.976 init_burn b rune_of_power Fluffy_Pillow 974122.3/1379444: 71% mana bloodlust, temptation, potion_of_deadly_grace
0:22.930 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 993862.1/1379444: 72% mana bloodlust, temptation, rune_of_power, potion_of_deadly_grace
0:22.930 burn O arcane_blast Fluffy_Pillow 993862.1/1379444: 72% mana bloodlust, temptation(2), rune_of_power, potion_of_deadly_grace
0:24.360 burn O arcane_blast Fluffy_Pillow 825451.2/1379444: 60% mana bloodlust, temptation(2), rune_of_power
0:25.789 burn N arcane_missiles Fluffy_Pillow 657019.6/1379444: 48% mana bloodlust, temptation(2), arcane_missiles, rune_of_power
0:27.379 burn O arcane_blast Fluffy_Pillow 689919.3/1379444: 50% mana bloodlust, temptation(2), rune_of_power
0:28.807 burn O arcane_blast Fluffy_Pillow 521467.0/1379444: 38% mana bloodlust, temptation(2), rune_of_power
0:30.237 burn O arcane_blast Fluffy_Pillow 353056.1/1379444: 26% mana bloodlust, temptation(2), rune_of_power
0:31.666 burn N arcane_missiles Fluffy_Pillow 184624.5/1379444: 13% mana bloodlust, temptation(2), arcane_missiles, rune_of_power
0:33.193 burn O arcane_blast Fluffy_Pillow 216220.6/1379444: 16% mana bloodlust, temptation(2)
0:34.623 burn P evocation Fluffy_Pillow 47809.7/1379444: 3% mana bloodlust, temptation(2), arcane_missiles
0:38.747 default 8 stop_burn_phase Fluffy_Pillow 1379444.0/1379444: 100% mana bloodlust, temptation(2), arcane_missiles
0:38.747 conserve R arcane_blast Fluffy_Pillow 1379444.0/1379444: 100% mana bloodlust, temptation(2), arcane_missiles
0:40.176 conserve S arcane_missiles Fluffy_Pillow 1181526.8/1379444: 86% mana temptation(2), arcane_missiles
0:42.027 conserve T arcane_barrage Fluffy_Pillow 1219827.0/1379444: 88% mana temptation(2)
0:43.266 build G arcane_blast Fluffy_Pillow 1239964.0/1379444: 90% mana temptation(2)
0:45.124 build G arcane_blast Fluffy_Pillow 1245409.1/1379444: 90% mana temptation(2), arcane_charge
0:46.980 build G arcane_blast Fluffy_Pillow 1209562.8/1379444: 88% mana temptation(2), arcane_charge(2)
0:48.838 build G arcane_blast Fluffy_Pillow 1132507.9/1379444: 82% mana temptation(2), arcane_charge(3)
0:50.696 conserve T arcane_barrage Fluffy_Pillow 1014203.0/1379444: 74% mana temptation(2), arcane_charge(4)
0:51.934 build G arcane_blast Fluffy_Pillow 1034319.3/1379444: 75% mana temptation(2)
0:53.792 build G arcane_blast Fluffy_Pillow 1039764.4/1379444: 75% mana arcane_charge
0:55.651 build G arcane_blast Fluffy_Pillow 1003980.2/1379444: 73% mana arcane_charge(2), arcane_missiles
0:57.508 build G arcane_blast Fluffy_Pillow 926904.6/1379444: 67% mana arcane_charge(3), arcane_missiles(2)
0:59.366 conserve S arcane_missiles Fluffy_Pillow 808599.7/1379444: 59% mana arcane_charge(4), arcane_missiles(2)
1:01.193 conserve S arcane_missiles Fluffy_Pillow 846403.4/1379444: 61% mana arcane_charge(4), arcane_missiles
1:03.171 conserve T arcane_barrage Fluffy_Pillow 887331.5/1379444: 64% mana arcane_charge(4)
1:04.410 build G arcane_blast Fluffy_Pillow 907468.5/1379444: 66% mana
1:06.268 default 9 mark_of_aluneth Fluffy_Pillow 912913.6/1379444: 66% mana arcane_charge
1:07.920 build G arcane_blast Fluffy_Pillow 947096.2/1379444: 69% mana arcane_charge
1:09.778 build G arcane_blast Fluffy_Pillow 911291.3/1379444: 66% mana arcane_charge(2)
1:11.635 build G arcane_blast Fluffy_Pillow 834215.7/1379444: 60% mana arcane_charge(3), arcane_missiles
1:13.491 init_burn b rune_of_power Fluffy_Pillow 715869.4/1379444: 52% mana arcane_charge(4), arcane_missiles
1:14.731 rop_phase e arcane_missiles Fluffy_Pillow 741527.1/1379444: 54% mana arcane_charge(4), arcane_missiles, rune_of_power
1:16.681 rop_phase f arcane_blast Fluffy_Pillow 781875.8/1379444: 57% mana arcane_charge(4), rune_of_power
1:18.537 rop_phase f arcane_blast Fluffy_Pillow 622279.5/1379444: 45% mana arcane_charge(4), rune_of_power
1:20.396 rop_phase g arcane_barrage Fluffy_Pillow 462745.3/1379444: 34% mana arcane_charge(4), rune_of_power
1:21.634 build G arcane_blast Fluffy_Pillow 482861.6/1379444: 35% mana rune_of_power
1:23.494 build G arcane_blast Fluffy_Pillow 488348.1/1379444: 35% mana arcane_charge, rune_of_power
1:25.351 build G arcane_blast Fluffy_Pillow 452522.5/1379444: 33% mana arcane_charge(2)
1:27.208 build G arcane_blast Fluffy_Pillow 375446.9/1379444: 27% mana arcane_charge(3), arcane_missiles
1:29.064 conserve S arcane_missiles Fluffy_Pillow 257100.6/1379444: 19% mana arcane_charge(4), arcane_missiles(2)
1:31.020 conserve S arcane_missiles Fluffy_Pillow 297573.5/1379444: 22% mana arcane_charge(4), arcane_missiles
1:32.899 conserve U arcane_blast Fluffy_Pillow 336453.2/1379444: 24% mana arcane_charge(4)
1:34.757 Waiting     1.000 sec 176898.3/1379444: 13% mana arcane_charge(4)
1:35.757 init_burn b rune_of_power Fluffy_Pillow 197589.9/1379444: 14% mana arcane_charge(4)
1:36.997 init_burn c start_burn_phase Fluffy_Pillow 223247.6/1379444: 16% mana arcane_charge(4), rune_of_power
1:36.997 cooldowns W arcane_power Fluffy_Pillow 223247.6/1379444: 16% mana arcane_charge(4), rune_of_power
1:36.997 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 223247.6/1379444: 16% mana arcane_charge(4), arcane_power, rune_of_power
1:36.997 cooldowns Z potion Fluffy_Pillow 223247.6/1379444: 16% mana temptation, arcane_charge(4), arcane_power, rune_of_power
1:36.997 burn M arcane_blast Fluffy_Pillow 223247.6/1379444: 16% mana temptation, arcane_charge(4), arcane_power, rune_of_power, potion_of_deadly_grace
1:38.853 burn M arcane_blast Fluffy_Pillow 202251.3/1379444: 15% mana temptation, arcane_charge(4), arcane_power, rune_of_power, potion_of_deadly_grace
1:40.710 burn M arcane_blast Fluffy_Pillow 181275.7/1379444: 13% mana temptation, arcane_charge(4), arcane_power, rune_of_power, potion_of_deadly_grace
1:42.567 burn M arcane_blast Fluffy_Pillow 160300.1/1379444: 12% mana temptation, arcane_charge(4), arcane_missiles, arcane_power, rune_of_power, potion_of_deadly_grace
1:44.425 burn K presence_of_mind Fluffy_Pillow 139345.2/1379444: 10% mana temptation, arcane_charge(4), arcane_missiles(2), arcane_power, rune_of_power, potion_of_deadly_grace
1:44.425 burn M arcane_blast Fluffy_Pillow 139345.2/1379444: 10% mana temptation, arcane_charge(4), arcane_missiles(2), arcane_power, presence_of_mind(2), rune_of_power, potion_of_deadly_grace
1:45.665 burn L arcane_missiles Fluffy_Pillow 105602.9/1379444: 8% mana temptation, arcane_charge(4), arcane_missiles(2), arcane_power, presence_of_mind, rune_of_power, potion_of_deadly_grace
1:47.636 burn M arcane_blast Fluffy_Pillow 146386.2/1379444: 11% mana temptation, arcane_charge(4), arcane_missiles, arcane_power, presence_of_mind, potion_of_deadly_grace
1:48.877 burn M arcane_blast Fluffy_Pillow 112664.5/1379444: 8% mana temptation, arcane_charge(4), arcane_missiles, arcane_power, potion_of_deadly_grace
1:50.734 burn O arcane_blast Fluffy_Pillow 91688.9/1379444: 7% mana temptation, arcane_charge(4), arcane_missiles, arcane_power, potion_of_deadly_grace
1:52.590 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 62.1/1379444: 0% mana temptation, arcane_charge(4), arcane_missiles, potion_of_deadly_grace
1:52.590 conserve S arcane_missiles Fluffy_Pillow 62.1/1379444: 0% mana temptation(2), arcane_charge(4), arcane_missiles, potion_of_deadly_grace
1:54.610 conserve T arcane_barrage Fluffy_Pillow 41859.2/1379444: 3% mana temptation(2), arcane_charge(4), potion_of_deadly_grace
1:55.850 build G arcane_blast Fluffy_Pillow 62016.9/1379444: 4% mana temptation(2), potion_of_deadly_grace
1:57.708 Waiting     0.400 sec 67462.0/1379444: 5% mana temptation(2), arcane_charge, potion_of_deadly_grace
1:58.108 build G arcane_blast Fluffy_Pillow 75738.7/1379444: 5% mana temptation(2), arcane_charge, potion_of_deadly_grace
1:59.966 conserve S arcane_missiles Fluffy_Pillow 39933.8/1379444: 3% mana temptation(2), arcane_charge(2), arcane_missiles, potion_of_deadly_grace
2:01.984 conserve T arcane_barrage Fluffy_Pillow 81689.5/1379444: 6% mana temptation(2), arcane_charge(3), potion_of_deadly_grace
2:03.223 build G arcane_blast Fluffy_Pillow 101826.5/1379444: 7% mana temptation(2)
2:05.083 build G arcane_blast Fluffy_Pillow 107313.0/1379444: 8% mana temptation(2), arcane_charge, arcane_missiles
2:06.941 cooldowns Y use_item_figurehead_of_the_naglfar Fluffy_Pillow 71508.1/1379444: 5% mana temptation(2), arcane_charge(2), arcane_missiles
2:06.945 burn P evocation Fluffy_Pillow 71590.9/1379444: 5% mana temptation(2), arcane_charge(2), arcane_missiles
2:12.165 default 8 stop_burn_phase Fluffy_Pillow 1379444.0/1379444: 100% mana temptation(2), arcane_charge(2), arcane_missiles
2:12.165 default 9 mark_of_aluneth Fluffy_Pillow 1379444.0/1379444: 100% mana temptation(2), arcane_charge(2), arcane_missiles
2:13.817 build G arcane_blast Fluffy_Pillow 1379444.0/1379444: 100% mana temptation(2), arcane_charge(2), arcane_missiles
2:15.676 build G arcane_blast Fluffy_Pillow 1264068.1/1379444: 92% mana temptation(2), arcane_charge(3), arcane_missiles(2)
2:17.535 init_burn b rune_of_power Fluffy_Pillow 1145783.9/1379444: 83% mana temptation(2), arcane_charge(4), arcane_missiles(2)
2:18.774 rop_phase e arcane_missiles Fluffy_Pillow 1171420.9/1379444: 85% mana temptation(2), arcane_charge(4), arcane_missiles(2), rune_of_power
2:20.813 rop_phase e arcane_missiles Fluffy_Pillow 1213611.2/1379444: 88% mana temptation(2), arcane_charge(4), arcane_missiles, rune_of_power
2:22.766 rop_phase f arcane_blast Fluffy_Pillow 1254022.0/1379444: 91% mana arcane_charge(4), rune_of_power
2:24.623 rop_phase f arcane_blast Fluffy_Pillow 1094446.4/1379444: 79% mana arcane_charge(4), rune_of_power
2:26.479 rop_phase e arcane_missiles Fluffy_Pillow 934850.2/1379444: 68% mana arcane_charge(4), arcane_missiles, rune_of_power
2:28.470 rop_phase f arcane_blast Fluffy_Pillow 976047.2/1379444: 71% mana arcane_charge(4), rune_of_power
2:30.330 conserve T arcane_barrage Fluffy_Pillow 816533.7/1379444: 59% mana arcane_charge(4)
2:31.572 build G arcane_blast Fluffy_Pillow 836732.8/1379444: 61% mana arcane_missiles
2:33.431 build G arcane_blast Fluffy_Pillow 842198.6/1379444: 61% mana arcane_charge, arcane_missiles
2:35.287 build G arcane_blast Fluffy_Pillow 806352.3/1379444: 58% mana arcane_charge(2), arcane_missiles(2)
2:37.146 build G arcane_blast Fluffy_Pillow 729318.1/1379444: 53% mana arcane_charge(3), arcane_missiles(2)
2:39.004 conserve S arcane_missiles Fluffy_Pillow 611013.2/1379444: 44% mana arcane_charge(4), arcane_missiles(3)
2:40.856 conserve S arcane_missiles Fluffy_Pillow 649334.1/1379444: 47% mana arcane_charge(4), arcane_missiles(2)
2:42.811 conserve S arcane_missiles Fluffy_Pillow 689786.3/1379444: 50% mana arcane_charge(4), arcane_missiles
2:44.678 conserve T arcane_barrage Fluffy_Pillow 728417.7/1379444: 53% mana arcane_charge(4)
2:45.917 build G arcane_blast Fluffy_Pillow 748554.6/1379444: 54% mana
2:47.775 build G arcane_blast Fluffy_Pillow 753999.7/1379444: 55% mana arcane_charge
2:49.632 build G arcane_blast Fluffy_Pillow 718174.2/1379444: 52% mana arcane_charge(2)
2:51.489 build G arcane_blast Fluffy_Pillow 641098.6/1379444: 46% mana arcane_charge(3)
2:53.347 conserve T arcane_barrage Fluffy_Pillow 522793.7/1379444: 38% mana arcane_charge(4)
2:54.587 build G arcane_blast Fluffy_Pillow 542951.3/1379444: 39% mana
2:56.443 build G arcane_blast Fluffy_Pillow 548355.1/1379444: 40% mana arcane_charge, arcane_missiles
2:58.300 build G arcane_blast Fluffy_Pillow 512529.5/1379444: 37% mana arcane_charge(2), arcane_missiles
3:00.157 build G arcane_blast Fluffy_Pillow 435453.9/1379444: 32% mana arcane_charge(3), arcane_missiles
3:02.014 conserve S arcane_missiles Fluffy_Pillow 317128.3/1379444: 23% mana arcane_charge(4), arcane_missiles(2)
3:03.801 conserve S arcane_missiles Fluffy_Pillow 354104.3/1379444: 26% mana arcane_charge(4), arcane_missiles
3:05.695 conserve U arcane_blast Fluffy_Pillow 393294.3/1379444: 29% mana arcane_charge(4)
3:07.552 conserve S arcane_missiles Fluffy_Pillow 233718.7/1379444: 17% mana arcane_charge(4), arcane_missiles
3:09.457 conserve U arcane_blast Fluffy_Pillow 273136.3/1379444: 20% mana arcane_charge(4)
3:11.314 Waiting     2.500 sec 113560.7/1379444: 8% mana arcane_charge(4)
3:13.814 init_burn a mark_of_aluneth Fluffy_Pillow 165289.9/1379444: 12% mana arcane_charge(4)
3:15.466 init_burn b rune_of_power Fluffy_Pillow 199472.5/1379444: 14% mana arcane_charge(4)
3:16.706 init_burn c start_burn_phase Fluffy_Pillow 225130.2/1379444: 16% mana arcane_charge(4), rune_of_power
3:16.706 cooldowns W arcane_power Fluffy_Pillow 225130.2/1379444: 16% mana arcane_charge(4), rune_of_power
3:16.706 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 225130.2/1379444: 16% mana arcane_charge(4), arcane_power, rune_of_power
3:16.706 burn M arcane_blast Fluffy_Pillow 225130.2/1379444: 16% mana temptation, arcane_charge(4), arcane_power, rune_of_power
3:18.564 burn M arcane_blast Fluffy_Pillow 204175.3/1379444: 15% mana temptation, arcane_charge(4), arcane_power, rune_of_power
3:20.422 burn M arcane_blast Fluffy_Pillow 183220.4/1379444: 13% mana temptation, arcane_charge(4), arcane_power, rune_of_power
3:22.280 burn M arcane_blast Fluffy_Pillow 162265.5/1379444: 12% mana temptation, arcane_charge(4), arcane_power, rune_of_power
3:24.137 burn K presence_of_mind Fluffy_Pillow 141289.9/1379444: 10% mana temptation, arcane_charge(4), arcane_power, rune_of_power
3:24.137 burn M arcane_blast Fluffy_Pillow 141289.9/1379444: 10% mana temptation, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power
3:25.375 burn M arcane_blast Fluffy_Pillow 107506.2/1379444: 8% mana temptation, arcane_charge(4), arcane_missiles, arcane_power, presence_of_mind, rune_of_power
3:26.616 burn L arcane_missiles Fluffy_Pillow 73784.5/1379444: 5% mana temptation, arcane_charge(4), arcane_missiles(2), arcane_power, rune_of_power
3:28.486 burn M arcane_blast Fluffy_Pillow 112477.9/1379444: 8% mana temptation, arcane_charge(4), arcane_missiles, arcane_power
3:30.344 burn O arcane_blast Fluffy_Pillow 91523.0/1379444: 7% mana temptation, arcane_charge(4), arcane_missiles, arcane_power
3:32.201 init_burn b rune_of_power Fluffy_Pillow 82.8/1379444: 0% mana temptation, arcane_charge(4), arcane_missiles
3:33.440 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 25719.7/1379444: 2% mana temptation, arcane_charge(4), arcane_missiles, rune_of_power
3:33.440 conserve S arcane_missiles Fluffy_Pillow 25719.7/1379444: 2% mana temptation(2), arcane_charge(4), arcane_missiles, rune_of_power
3:35.349 conserve T arcane_barrage Fluffy_Pillow 65220.1/1379444: 5% mana temptation(2), arcane_charge(4), rune_of_power
3:36.590 build G arcane_blast Fluffy_Pillow 85398.5/1379444: 6% mana temptation(2), arcane_missiles, rune_of_power
3:38.448 build G arcane_blast Fluffy_Pillow 90843.6/1379444: 7% mana temptation(2), arcane_charge, arcane_missiles, rune_of_power
3:40.307 burn P evocation Fluffy_Pillow 55059.4/1379444: 4% mana temptation(2), arcane_charge(2), arcane_missiles, rune_of_power
3:45.513 default 8 stop_burn_phase Fluffy_Pillow 1379444.0/1379444: 100% mana temptation(2), arcane_charge(2), arcane_missiles
3:45.513 build G arcane_blast Fluffy_Pillow 1379444.0/1379444: 100% mana temptation(2), arcane_charge(2), arcane_missiles
3:47.371 build G arcane_blast Fluffy_Pillow 1264047.5/1379444: 92% mana temptation(2), arcane_charge(3), arcane_missiles
3:49.229 conserve S arcane_missiles Fluffy_Pillow 1145742.6/1379444: 83% mana temptation(2), arcane_charge(4), arcane_missiles(2)
3:51.169 conserve S arcane_missiles Fluffy_Pillow 1185884.4/1379444: 86% mana temptation(2), arcane_charge(4), arcane_missiles
3:52.908 conserve T arcane_barrage Fluffy_Pillow 1221867.2/1379444: 89% mana temptation(2), arcane_charge(4)
3:54.149 build G arcane_blast Fluffy_Pillow 1242045.5/1379444: 90% mana temptation(2), arcane_missiles
3:56.007 build G arcane_blast Fluffy_Pillow 1247490.6/1379444: 90% mana temptation(2), arcane_charge, arcane_missiles
3:57.864 build G arcane_blast Fluffy_Pillow 1211665.0/1379444: 88% mana temptation(2), arcane_charge(2), arcane_missiles
3:59.721 build G arcane_blast Fluffy_Pillow 1134589.5/1379444: 82% mana temptation(2), arcane_charge(3), arcane_missiles(2)
4:01.579 conserve S arcane_missiles Fluffy_Pillow 1016284.6/1379444: 74% mana temptation(2), arcane_charge(4), arcane_missiles(3)
4:03.541 conserve S arcane_missiles Fluffy_Pillow 1056881.6/1379444: 77% mana arcane_charge(4), arcane_missiles(2)
4:05.509 conserve S arcane_missiles Fluffy_Pillow 1097602.8/1379444: 80% mana arcane_charge(4), arcane_missiles
4:07.447 conserve T arcane_barrage Fluffy_Pillow 1137703.2/1379444: 82% mana arcane_charge(4)
4:08.686 build G arcane_blast Fluffy_Pillow 1157840.2/1379444: 84% mana
4:10.545 build G arcane_blast Fluffy_Pillow 1163306.0/1379444: 84% mana arcane_charge
4:12.403 build G arcane_blast Fluffy_Pillow 1127501.1/1379444: 82% mana arcane_charge(2)
4:14.260 build G arcane_blast Fluffy_Pillow 1050425.5/1379444: 76% mana arcane_charge(3), arcane_missiles
4:16.118 default 9 mark_of_aluneth Fluffy_Pillow 932120.6/1379444: 68% mana arcane_charge(4), arcane_missiles
4:17.770 conserve S arcane_missiles Fluffy_Pillow 966303.2/1379444: 70% mana arcane_charge(4), arcane_missiles
4:19.606 init_burn b rune_of_power Fluffy_Pillow 1004293.1/1379444: 73% mana arcane_charge(4)
4:20.845 init_burn c start_burn_phase Fluffy_Pillow 1029930.1/1379444: 75% mana arcane_charge(4), rune_of_power
4:20.845 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 1029930.1/1379444: 75% mana arcane_charge(4), rune_of_power
4:20.845 cooldowns Y use_item_figurehead_of_the_naglfar Fluffy_Pillow 1029930.1/1379444: 75% mana temptation, arcane_charge(4), rune_of_power
4:20.845 burn O arcane_blast Fluffy_Pillow 1029930.1/1379444: 75% mana temptation, arcane_charge(4), rune_of_power
4:22.703 burn O arcane_blast Fluffy_Pillow 870375.2/1379444: 63% mana temptation, arcane_charge(4), rune_of_power
4:24.562 burn O arcane_blast Fluffy_Pillow 710841.0/1379444: 52% mana temptation, arcane_charge(4), rune_of_power
4:26.419 burn N arcane_missiles Fluffy_Pillow 551265.4/1379444: 40% mana temptation, arcane_charge(4), arcane_missiles, rune_of_power
4:28.280 burn K presence_of_mind Fluffy_Pillow 589772.6/1379444: 43% mana temptation, arcane_charge(4), rune_of_power
4:28.280 burn M arcane_blast Fluffy_Pillow 589772.6/1379444: 43% mana temptation, arcane_charge(4), presence_of_mind(2), rune_of_power
4:29.519 burn M arcane_blast Fluffy_Pillow 417409.5/1379444: 30% mana temptation, arcane_charge(4), arcane_missiles, presence_of_mind, rune_of_power
4:30.759 burn N arcane_missiles Fluffy_Pillow 245067.2/1379444: 18% mana temptation, arcane_charge(4), arcane_missiles, rune_of_power
4:32.670 burn O arcane_blast Fluffy_Pillow 284609.0/1379444: 21% mana temptation, arcane_charge(4)
4:34.530 conserve T arcane_barrage Fluffy_Pillow 125095.5/1379444: 9% mana temptation, arcane_charge(4)
4:35.770 build G arcane_blast Fluffy_Pillow 145253.1/1379444: 11% mana temptation
4:37.628 build G arcane_blast Fluffy_Pillow 150698.2/1379444: 11% mana temptation, arcane_charge
4:39.486 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 114893.3/1379444: 8% mana temptation, arcane_charge(2)
4:39.486 conserve T arcane_barrage Fluffy_Pillow 114893.3/1379444: 8% mana temptation(2), arcane_charge(2)
4:40.726 build G arcane_blast Fluffy_Pillow 135051.0/1379444: 10% mana temptation(2)
4:42.582 build G arcane_blast Fluffy_Pillow 140454.7/1379444: 10% mana temptation(2), arcane_charge, arcane_missiles
4:44.438 conserve S arcane_missiles Fluffy_Pillow 104608.4/1379444: 8% mana temptation(2), arcane_charge(2), arcane_missiles
4:46.455 Waiting     0.100 sec 146343.5/1379444: 11% mana temptation(2), arcane_charge(3)
4:46.555 cooldowns W arcane_power Fluffy_Pillow 148412.7/1379444: 11% mana temptation(2), arcane_charge(3)
4:46.706 build G arcane_blast Fluffy_Pillow 151537.1/1379444: 11% mana temptation(2), arcane_charge(3), arcane_power
4:48.562 init_burn b rune_of_power Fluffy_Pillow 142915.8/1379444: 10% mana temptation(2), arcane_charge(4), arcane_missiles, arcane_power
4:49.801 burn M arcane_blast Fluffy_Pillow 168552.8/1379444: 12% mana temptation(2), arcane_charge(4), arcane_missiles, arcane_power, rune_of_power
4:51.659 burn M arcane_blast Fluffy_Pillow 147597.9/1379444: 11% mana temptation(2), arcane_charge(4), arcane_missiles, arcane_power, rune_of_power
4:53.518 burn M arcane_blast Fluffy_Pillow 126663.7/1379444: 9% mana temptation(2), arcane_charge(4), arcane_missiles(2), arcane_power, rune_of_power
4:55.377 cooldowns X use_item_ring_of_collapsing_futures Fluffy_Pillow 105729.5/1379444: 8% mana temptation(2), arcane_charge(4), arcane_missiles(2), arcane_power, rune_of_power
4:55.377 burn L arcane_missiles Fluffy_Pillow 105729.5/1379444: 8% mana temptation(3), arcane_charge(4), arcane_missiles(2), arcane_power, rune_of_power
4:57.309 burn M arcane_blast Fluffy_Pillow 145705.8/1379444: 11% mana temptation(3), arcane_charge(4), arcane_missiles, arcane_power, rune_of_power
4:59.167 burn O arcane_blast Fluffy_Pillow 124750.9/1379444: 9% mana temptation(3), arcane_charge(4), arcane_missiles, arcane_power, rune_of_power
5:01.025 conserve S arcane_missiles Fluffy_Pillow 103.5/1379444: 0% mana temptation(3), arcane_charge(4), arcane_missiles(2)
5:02.992 conserve S arcane_missiles Fluffy_Pillow 40804.0/1379444: 3% mana temptation(3), arcane_charge(4), arcane_missiles

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4875 4550 0
Agility 6577 6252 0
Stamina 35149 35149 22087
Intellect 33303 31597 22765 (731)
Spirit 0 0 0
Health 2108940 2108940 0
Mana 1379444 1379444 0
Spell Power 33303 31597 0
Melee Crit 26.47% 25.52% 8208
Spell Crit 29.47% 28.52% 8208
Haste 21.40% 21.40% 8025
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 20692 20692 0
Mastery 25.40% 25.40% 5268
Armor 1642 1642 1642
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 859.00
Local Head Night Dreamer Crest
ilevel: 845, stats: { 208 Armor, +1299 Int, +1949 Sta, +931 Haste, +413 Mastery }
Local Neck Pendant of Cold Flame
ilevel: 860, stats: { +1261 Sta, +1249 Haste, +1052 Crit }
Local Shoulders Chaos-Scarred Mantle
ilevel: 870, stats: { 210 Armor, +1846 Sta, +1231 Int, +744 Crit, +364 Mastery }
Local Chest Robes of Celestial Adornment
ilevel: 845, stats: { 256 Armor, +1949 Sta, +1299 Int, +788 Haste, +557 Crit }
Local Waist Poisonroot Belt
ilevel: 835, stats: { 139 Armor, +888 Int, +1332 Sta, +569 Mastery, +403 Crit }
Local Legs Sunfrost Leggings
ilevel: 845, stats: { 224 Armor, +1299 Int, +1949 Sta, +788 Haste, +557 Crit }
Local Feet Perpetually Muddy Sandals
ilevel: 870, stats: { 192 Armor, +1846 Sta, +1231 Int, +601 Mastery, +506 Haste, +475 Avoidance }
Local Wrists Bracelets of the Sorrowful Bride
ilevel: 855, stats: { 116 Armor, +803 Int, +1204 Sta, +510 Crit, +275 Mastery }
Local Hands Faded Bloodsail Handwraps
ilevel: 860, stats: { 169 Armor, +1681 Sta, +1121 Int, +739 Haste, +327 Mastery }
Local Finger1 Ring of Collapsing Futures
ilevel: 860, stats: { +1261 Sta, +1578 Mastery, +723 Haste }
Local Finger2 Sephuz's Secret
ilevel: 910, stats: { +2010 Sta, +890 Haste, +2227 Crit }
Local Trinket1 Bleached Skull Talisman
ilevel: 845, stats: { +1236 Int, +961 Crit }
Local Trinket2 Figurehead of the Naglfar
ilevel: 865, stats: { +1036 Crit }
Local Back Seacursed Wrap
ilevel: 845, stats: { 128 Armor, +731 StrAgiInt, +1097 Sta, +486 Haste, +270 Mastery }
Local Main Hand Aluneth
ilevel: 880, weapon: { 4437 - 6658, 3.6 }, stats: { +1801 Int, +2702 Sta, +768 Haste, +768 Mastery, +9826 Int }, relics: { +45 ilevels, +49 ilevels, +36 ilevels }

Talents

Level
15 Arcane Familiar (Arcane Mage) Amplification (Arcane Mage) Words of Power (Arcane Mage)
30 Shimmer Slipstream (Arcane Mage) Mana Shield (Arcane Mage)
45 Mirror Image Rune of Power Incanter's Flow
60 Supernova (Arcane Mage) Charged Up (Arcane Mage) Resonance (Arcane Mage)
75 Chrono Shift (Arcane Mage) Ring of Frost Ice Ward
90 Nether Tempest (Arcane Mage) Unstable Magic Erosion (Arcane Mage)
100 Overpowered Temporal Flux (Arcane Mage) Arcane Orb (Arcane Mage)

Profile

mage="Eldiablø"
origin="https://eu.api.battle.net/wow/character/hyjal/Eldiablø/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/113/123831665-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=inscription=314/herbalism=39
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ea!1112210
artifact=4:0:0:0:0:73:1:74:3:75:3:79:3:80:1:81:3:82:3:83:3:84:3:86:1:87:1:290:1:1339:1
spec=arcane

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/summon_arcane_familiar
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/arcane_blast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(buff.bloodlust.down)&((time=0)|(equipped.132410&buff.arcane_power.up&prev_off_gcd.arcane_power)|(target.time_to_die<40))
actions+=/mirror_image,if=buff.arcane_power.down
actions+=/stop_burn_phase,if=prev_gcd.1.evocation&burn_phase_duration>gcd.max
actions+=/mark_of_aluneth,if=cooldown.arcane_power.remains>20
actions+=/call_action_list,name=build,if=buff.arcane_charge.stack<4
actions+=/call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
actions+=/call_action_list,name=burn,if=burn_phase
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
actions+=/call_action_list,name=conserve

actions.build=charged_up,if=buff.arcane_charge.stack<=1
actions.build+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.build+=/arcane_orb
actions.build+=/arcane_explosion,if=active_enemies>1
actions.build+=/arcane_blast

actions.burn=call_action_list,name=cooldowns
actions.burn+=/charged_up,if=(equipped.132451&buff.arcane_charge.stack<=1)
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.burn+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.burn+=/arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/presence_of_mind,if=buff.rune_of_power.remains<=2*action.arcane_blast.execute_time
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react>1
actions.burn+=/arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
actions.burn+=/arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
actions.burn+=/supernova,if=mana.pct<100
actions.burn+=/arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
actions.burn+=/arcane_explosion,if=active_enemies>1
actions.burn+=/arcane_barrage,if=(equipped.132451&cooldown.charged_up.remains=0&mana.pct<(100-(buff.arcane_charge.stack*0.03)))
actions.burn+=/arcane_blast
actions.burn+=/evocation,interrupt_if=mana.pct>99

actions.conserve=arcane_missiles,if=buff.arcane_missiles.react=3
actions.conserve+=/arcane_blast,if=mana.pct>99
actions.conserve+=/nether_tempest,if=(refreshable|!ticking)
actions.conserve+=/arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
actions.conserve+=/arcane_missiles
actions.conserve+=/supernova,if=mana.pct<100
actions.conserve+=/arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
actions.conserve+=/arcane_blast,if=mana.pct>=82&equipped.132451
actions.conserve+=/arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
actions.conserve+=/arcane_explosion,if=active_enemies>1
actions.conserve+=/arcane_blast

actions.cooldowns=rune_of_power,if=mana.pct>45&buff.arcane_power.down
actions.cooldowns+=/arcane_power
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/use_item,slot=finger1
actions.cooldowns+=/use_item,slot=trinket2
actions.cooldowns+=/potion,name=deadly_grace,if=buff.arcane_power.up

actions.init_burn=mark_of_aluneth
actions.init_burn+=/nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.1.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
actions.init_burn+=/rune_of_power
actions.init_burn+=/start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55

actions.rop_phase=arcane_missiles,if=buff.arcane_missiles.react=3
actions.rop_phase+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.rop_phase+=/arcane_missiles,if=buff.arcane_charge.stack=4
actions.rop_phase+=/arcane_explosion,if=active_enemies>1
actions.rop_phase+=/arcane_blast,if=mana.pct>45
actions.rop_phase+=/arcane_barrage

head=night_dreamer_crest,id=139086,bonus_id=3474/1507/1674
neck=pendant_of_cold_flame,id=141438,bonus_id=3466/1472
shoulders=chaosscarred_mantle,id=140853,bonus_id=3443/1467/1813
back=seacursed_wrap,id=133771,bonus_id=3410/1808/1497/1813
chest=robes_of_celestial_adornment,id=142410,bonus_id=3470/1462
wrists=bracelets_of_the_sorrowful_bride,id=142154,bonus_id=3452/1472
hands=faded_bloodsail_handwraps,id=141470,bonus_id=3466/1472
waist=poisonroot_belt,id=134423,bonus_id=1726/1487/3336
legs=sunfrost_leggings,id=139126,bonus_id=3474/1507/1674
feet=perpetually_muddy_sandals,id=140854,bonus_id=3443/1808/40/1467/1813
finger1=ring_of_collapsing_futures,id=142173,bonus_id=3453/1472
finger2=sephuzs_secret,id=132452,bonus_id=3459/3458
trinket1=bleached_skull_talisman,id=134204,bonus_id=3473/1808/603/1507/3336
trinket2=figurehead_of_the_naglfar,id=137329,bonus_id=3410/1517/3337
main_hand=aluneth,id=127857,bonus_id=729,gem_id=143807/140831/142056/0,relic_id=3490:1647:3337/3443:1467:1813/0/0

# Gear Summary
# gear_ilvl=859.33
# gear_stamina=22087
# gear_intellect=22765
# gear_crit_rating=8047
# gear_haste_rating=7868
# gear_mastery_rating=5165
# gear_avoidance_rating=475
# gear_armor=1642

Lâstykökö

Lâstykökö : 450890 dps

  • Race: Gnome
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
450889.9 450889.9 402.8 / 0.089% 81111.5 / 18.0% 25.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
17934.5 17934.5 Mana 0.00% 48.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Lâstykökö/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Incanter's Flow
  • 60: Flame On (Fire Mage)
  • 75: Frenetic Speed (Fire Mage)
  • 90: Unstable Magic
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • tailoring: 800
  • enchanting: 696

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Lâstykökö 450890
Blast Furnace (blast_furance) 4782 1.1% 38.7 7.84sec 37224 0 Periodic 260.9 3277 7076 5516 58.9% 85.8%

Stats details: blast_furance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.66 0.00 260.93 260.93 0.0000 0.9887 1439250.23 1439250.23 0.00 5578.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.2 41.07% 3277.08 3 3553 3277.05 3123 3365 351149 351149 0.00
crit 153.8 58.93% 7075.87 6 8051 7076.16 6849 7273 1088101 1088101 0.00
 
 

Action details: blast_furance

Static Values
  • id:194522
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:194522
  • name:Blast Furnace
  • school:fire
  • tooltip:Deals {$s1=1} Fire damage every $t1 sec.
  • description:Deals {$s1=1} Fire damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_dot) 1068 0.2% 88.9 3.21sec 3613 0 Periodic 137.3 2340 0 2340 0.0% 90.1%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.94 0.00 137.32 137.32 0.0000 1.9737 321334.75 321334.75 0.00 1185.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.3 100.00% 2340.01 1 2537 2340.14 2292 2371 321335 321335 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 3579 0.8% 30.0 9.67sec 35861 0 Direct 30.0 21308 45814 35862 59.4%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.03 30.03 0.00 0.00 0.0000 0.0000 1076812.65 1076812.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.19 40.61% 21307.90 19789 22833 21308.17 19789 22453 259848 259848 0.00
crit 17.83 59.39% 45813.71 40765 51740 45814.16 43025 48744 816965 816965 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 15210 3.3% 27.1 4.05sec 165750 0 Direct 27.1 91067 194524 165745 72.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.14 27.14 0.00 0.00 0.0000 0.0000 4498236.56 4498236.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.55 27.81% 91066.62 84576 97588 91061.55 84576 97588 687355 687355 0.00
crit 19.59 72.19% 194523.97 169152 214693 194550.68 183746 203359 3810881 3810881 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Dragon's Breath 948 0.2% 0.9 129.34sec 308575 266486 Direct 0.9 0 308568 308568 100.0%  

Stats details: dragons_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.92 0.92 0.00 0.00 1.1580 0.0000 284873.99 284873.99 0.00 266486.43 266486.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.92 100.00% 308567.71 286468 330541 197881.17 0 330541 284874 284874 0.00
 
 

Action details: dragons_breath

Static Values
  • id:31661
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:44000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132863|(talent.alexstraszas_fury.enabled&buff.hot_streak.down)
Spelldata
  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fire Blast 29838 6.6% 38.7 7.84sec 232018 0 Direct 38.7 0 232018 232018 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.66 38.66 0.00 0.00 0.0000 0.0000 8970877.95 8970877.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 38.66 100.00% 232017.70 206674 262317 232020.69 225275 240093 8970878 8970878 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum {$s2=1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 57873 12.9% 89.1 3.21sec 195485 115500 Direct 88.9 118317 250707 195917 58.6%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.13 88.94 0.00 0.00 1.6925 0.0000 17424049.78 17424049.78 0.00 115499.67 115499.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.81 41.38% 118317.45 110240 127200 118315.11 114904 122783 4354693 4354693 0.00
crit 52.13 58.62% 250707.10 227094 288235 250694.71 243149 258255 13069357 13069357 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 94099 20.9% 229.8 1.32sec 123175 0 Periodic 299.7 94457 0 94457 0.0% 99.6%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.83 0.00 299.71 299.71 0.0000 1.0000 28309907.99 28309907.99 0.00 94457.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.7 100.00% 94456.53 18297 315495 94455.33 78524 112474 28309908 28309908 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Maddening Whispers 12648 2.8% 2.2 163.17sec 1697061 0 Direct 2.2 811618 1783497 1697092 91.1%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.24 2.24 0.00 0.00 0.0000 0.0000 3809604.54 3809604.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.20 8.89% 811618.08 753134 869000 161120.06 0 869000 162021 162021 0.00
crit 2.05 91.11% 1783497.26 1506267 1911801 1783279.88 1581580 1911801 3647584 3647584 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. This may only occur once every ${$proccooldown}.1 sec. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70501.86
  • base_dd_max:70501.86
 
Mark of the Hidden Satyr 9324 2.1% 17.6 16.86sec 159563 0 Direct 17.6 94697 203570 159563 59.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.58 17.58 0.00 0.00 0.0000 0.0000 2805166.41 2805166.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 40.42% 94697.46 87945 101475 94597.83 0 101475 672920 672920 0.00
crit 10.47 59.58% 203570.34 181166 229941 203562.50 184650 226109 2132246 2132246 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix Reborn 3306 0.7% 25.0 11.68sec 39842 0 Direct 25.0 23676 50894 39842 59.4%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.96 24.96 0.00 0.00 0.0000 0.0000 994435.57 994435.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.13 40.60% 23675.93 21986 25369 23674.00 0 25369 239939 239939 0.00
crit 14.82 59.40% 50894.22 45291 57485 50902.02 47475 54286 754496 754496 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 19359 4.3% 14.6 22.49sec 397965 335100 Direct 14.6 0 398734 398734 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.57 0.00 0.00 1.1877 0.0000 5809955.51 5809955.51 0.00 335099.52 335099.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 14.57 100.00% 398733.78 343765 436317 398701.79 379882 418776 5809956 5809956 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Poisoned Dreams (_damage) 20448 4.5% 91.8 2.55sec 67066 0 Direct 91.8 41528 84772 67065 59.1%  

Stats details: poisoned_dreams_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.85 91.85 0.00 0.00 0.0000 0.0000 6159726.93 6159726.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.61 40.94% 41528.15 6996 80722 41501.14 0 64847 1561705 1561705 0.00
crit 54.24 59.06% 84771.61 13992 177589 84681.73 51095 109599 4598021 4598021 0.00
 
 

Action details: poisoned_dreams_damage

Static Values
  • id:222705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222705
  • name:Poisoned Dreams
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to afflict the target with Nightmare Corruption for {$222706d=20 seconds}, causing your spells to deal up to {$s1=3738} additional damage as Shadow. Every $222706t2 sec Nightmare Corruption attempts to spread to a nearby enemy. If no uninfected enemies are nearby, the intensity of the Corruption increases.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6549.16
  • base_dd_max:6549.16
 
Pyroblast 170776 37.9% 85.3 3.53sec 602157 398452 Direct 86.1 349814 720746 596697 66.6%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.30 86.08 0.00 0.00 1.5112 0.0000 51364456.14 51364456.14 0.00 398452.07 398452.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.79 33.44% 349814.25 229379 1058670 349051.31 241730 546274 10070026 10070026 0.00
crit 57.29 66.56% 720746.46 472520 2398947 720050.04 537834 1007309 41294430 41294430 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 405 0.1% 1.7 59.31sec 73746 63778 Direct 1.7 0 73746 73746 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.66 1.66 0.00 0.00 1.1567 0.0000 122645.15 122645.15 0.00 63778.03 63778.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 1.66 100.00% 73746.42 62505 79333 58716.48 0 79333 122645 122645 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unstable Magic (_explosion) 7228 1.6% 22.2 12.40sec 97995 0 Direct 22.2 97995 0 97995 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.21 22.21 0.00 0.00 0.0000 0.0000 2176286.09 2176286.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.21 100.00% 97994.81 55120 144118 98084.55 71513 127085 2176286 2176286 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=20}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:131714.79
  • base_dd_max:131714.79
 
Simple Action Stats Execute Interval
Lâstykökö
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
Combustion 4.2 82.19sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 14.6 21.37sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Time Warp 2.5 223.73sec

Stats details: time_warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: time_warp

Static Values
  • id:80353
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:44000.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410&(cooldown.combustion.remains<1|target.time_to_die.remains<50))
Spelldata
  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by {$s1=30}%.
  • description:Warp the flow of time, increasing haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 2.5 1.0 127.2sec 223.5sec 31.09% 34.40% 1.0(1.0) 2.2

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:31.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.2 0.0 81.5sec 82.2sec 13.84% 90.92% 83.1(83.1) 4.1

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:13.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 25.0 11.8 11.4sec 7.7sec 39.45% 40.32% 0.0(0.0) 0.5

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:29.93%
  • enhanced_pyrotechnics_2:7.46%
  • enhanced_pyrotechnics_3:1.75%
  • enhanced_pyrotechnics_4:0.29%
  • enhanced_pyrotechnics_5:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 84.0 0.0 3.6sec 3.6sec 38.46% 47.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:38.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 75.0 0.0 4.0sec 4.0sec 18.30% 86.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:18.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Kael'thas's Ultimate Ability (kaelthas_ultimate_ability) 10.7 0.6 27.1sec 25.5sec 19.09% 19.09% 0.6(0.6) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_kaelthas_ultimate_ability
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • kaelthas_ultimate_ability_1:19.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209455
  • name:Kael'thas's Ultimate Ability
  • tooltip:Increases the damage of your next non-instant Pyroblast by {$s1=300}%.
  • description:{$@spelldesc209450=After consuming Hot Streak, there is a {$s1=15}% chance that your next non-instant Pyroblast cast within {$209455d=15 seconds} deals {$209455s1=300}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maddening Whispers 2.3 0.0 161.7sec 166.0sec 6.13% 6.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.82%
  • maddening_whispers_2:0.73%
  • maddening_whispers_3:0.68%
  • maddening_whispers_4:0.68%
  • maddening_whispers_5:0.64%
  • maddening_whispers_6:0.67%
  • maddening_whispers_7:0.68%
  • maddening_whispers_8:0.52%
  • maddening_whispers_9:0.28%
  • maddening_whispers_10:0.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. This may only occur once every ${$proccooldown}.1 sec. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 79.9sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 44.5 120.8 6.8sec 1.8sec 65.63% 100.00% 43.9(43.9) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:20.89%
  • pyretic_incantation_2:12.02%
  • pyretic_incantation_3:4.12%
  • pyretic_incantation_4:7.58%
  • pyretic_incantation_5:21.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Incanter's Flow

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_incanters_flow
  • max_stacks:5
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • incanters_flow_1:20.00%
  • incanters_flow_2:20.00%
  • incanters_flow_3:20.00%
  • incanters_flow_4:20.00%
  • incanters_flow_5:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116267
  • name:Incanter's Flow
  • tooltip:Increases spell damage by $w1%.
  • description:{$@spelldesc1463=Magical energy flows through you while in combat, building up to ${$116267m1*5}% increased damage and then diminishing down to {$116267s1=4}% increased damage, cycling every 10 sec.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Heating Up generated 84.0 3.6sec
Heating Up removed 8.5 30.1sec
IB conversions of HU 38.4 7.9sec
Total Hot Streak procs 75.0 4.0sec
Hot Streak spells used 229.9 1.3sec
Hot Streak spell crits 164.3 1.8sec
Wasted Hot Streak spell crits 5.3 46.8sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Resources

Resource Usage Type Count Total Average RPE APR
Lâstykökö
combustion Mana 4.2 466931.1 110000.0 109994.9 0.0
dragons_breath Mana 0.9 40614.4 44000.0 43993.4 7.0
fire_blast Mana 38.7 425304.4 11000.0 10999.8 21.1
fireball Mana 89.1 1960860.2 22000.0 21999.4 8.9
pyroblast Mana 86.3 2373249.7 27500.0 27822.2 21.6
scorch Mana 1.7 18294.5 11000.0 11000.5 6.7
time_warp Mana 2.5 109826.3 44000.0 43993.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 549.18 4956559.37 (100.00%) 9025.36 15.13 0.00%
Resource RPS-Gain RPS-Loss
Mana 16476.41 17934.52
Combat End Resource Mean Min Max
Mana 717092.13 367889.50 1077296.00

Benefits & Uptimes

Benefits %
Incanter's Flow Incanter's Flow 1 19.8%
Incanter's Flow Incanter's Flow 2 19.2%
Incanter's Flow Incanter's Flow 3 19.2%
Incanter's Flow Incanter's Flow 4 20.5%
Incanter's Flow Incanter's Flow 5 21.3%
Uptimes %
Mana Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data Lâstykökö Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Lâstykökö Damage Per Second
Count 9999
Mean 450889.93
Minimum 386437.62
Maximum 528370.46
Spread ( max - min ) 141932.84
Range [ ( max - min ) / 2 * 100% ] 15.74%
Standard Deviation 20549.2625
5th Percentile 417985.83
95th Percentile 485631.37
( 95th Percentile - 5th Percentile ) 67645.54
Mean Distribution
Standard Deviation 205.5029
95.00% Confidence Intervall ( 450487.15 - 451292.71 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7979
0.1 Scale Factor Error with Delta=300 3604759
0.05 Scale Factor Error with Delta=300 14419034
0.01 Scale Factor Error with Delta=300 360475827
Priority Target DPS
Sample Data Lâstykökö Priority Target Damage Per Second
Count 9999
Mean 450889.93
Minimum 386437.62
Maximum 528370.46
Spread ( max - min ) 141932.84
Range [ ( max - min ) / 2 * 100% ] 15.74%
Standard Deviation 20549.2625
5th Percentile 417985.83
95th Percentile 485631.37
( 95th Percentile - 5th Percentile ) 67645.54
Mean Distribution
Standard Deviation 205.5029
95.00% Confidence Intervall ( 450487.15 - 451292.71 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7979
0.1 Scale Factor Error with Delta=300 3604759
0.05 Scale Factor Error with Delta=300 14419034
0.01 Scale Factor Error with Delta=300 360475827
DPS(e)
Sample Data Lâstykökö Damage Per Second (Effective)
Count 9999
Mean 450889.93
Minimum 386437.62
Maximum 528370.46
Spread ( max - min ) 141932.84
Range [ ( max - min ) / 2 * 100% ] 15.74%
Damage
Sample Data Lâstykökö Damage
Count 9999
Mean 135567620.22
Minimum 93450496.08
Maximum 185428693.36
Spread ( max - min ) 91978197.28
Range [ ( max - min ) / 2 * 100% ] 33.92%
DTPS
Sample Data Lâstykökö Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Lâstykökö Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Lâstykökö Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Lâstykökö Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Lâstykökö Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Lâstykökö Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data LâstykököTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Lâstykökö Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
7 2.50 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410&(cooldown.combustion.remains<1|target.time_to_die.remains<50))
0.00 mirror_image,if=buff.combustion.down
0.00 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
8 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
9 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
A 0.00 call_action_list,name=standard_rotation
actions.combustion_phase
# count action,conditions
0.00 rune_of_power,if=buff.combustion.down
B 0.00 call_action_list,name=active_talents
C 4.24 combustion
D 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
E 2.31 use_item,slot=trinket1
F 2.97 pyroblast,if=buff.kaelthas_ultimate_ability.react&buff.combustion.remains>execute_time
G 22.10 pyroblast,if=buff.hot_streak.up
H 13.22 fire_blast,if=buff.heating_up.up
I 6.19 phoenixs_flames
J 1.69 scorch,if=buff.combustion.remains>cast_time
K 0.92 dragons_breath,if=buff.hot_streak.down&action.fire_blast.charges<1&action.phoenixs_flames.charges<1
0.00 scorch,if=target.health.pct<=30&equipped.132454
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=((talent.flame_patch.enabled&active_enemies>1)|active_enemies>3)&buff.hot_streak.up
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
M 49.98 pyroblast,if=buff.hot_streak.up&!prev_gcd.1.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&equipped.132454
N 10.38 pyroblast,if=buff.kaelthas_ultimate_ability.react&execute_time<buff.kaelthas_ultimate_ability.remains
O 0.00 call_action_list,name=active_talents
P 0.65 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
Q 24.79 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
R 8.41 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 flamestrike,if=(talent.flame_patch.enabled&active_enemies>1)|active_enemies>5
0.00 scorch,if=target.health.pct<=30&equipped.132454
S 89.57 fireball

Sample Sequence

012567CEIGHGHGHGIGIGHGSSSSSQMSMRSQMSSMSQMSSSSQMSMSSSMQSMSRMSSQMSSMSSSSSSSSS7CDHGHGHGIGJGHGJGRMSQMSSSSSQMSMSMRQMSSSQMSSMSSSSSSQMQSMSMSMSMSMSMSMSSCEHGGHGHGIGIGQSMSSSMQSMRMNSSSQMSSSSQMSMQSMSQMNSMNNSSSSQMSSSMSCIGHGHGHGJGIMSQMSSSSQMSSMSMSMNNSQMQSMRQMSSSRM7PSSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Lâstykökö 1155000.0/1155000: 100% mana
Pre precombat 1 food Lâstykökö 1155000.0/1155000: 100% mana
Pre precombat 2 augmentation Lâstykökö 1155000.0/1155000: 100% mana
Pre precombat 5 potion Fluffy_Pillow 1155000.0/1155000: 100% mana potion_of_deadly_grace
0:00.000 precombat 6 pyroblast Fluffy_Pillow 1127500.0/1155000: 98% mana potion_of_deadly_grace
0:00.000 default 7 time_warp Fluffy_Pillow 1127500.0/1155000: 98% mana potion_of_deadly_grace
0:00.000 combustion_phase C combustion Fluffy_Pillow 1083500.0/1155000: 94% mana bloodlust, potion_of_deadly_grace
0:00.000 combustion_phase E use_item_wriggling_sinew Fluffy_Pillow 973500.0/1155000: 84% mana bloodlust, combustion, potion_of_deadly_grace
0:00.000 combustion_phase I phoenixs_flames Fluffy_Pillow 973500.0/1155000: 84% mana bloodlust, combustion, maddening_whispers(10), potion_of_deadly_grace
0:01.033 combustion_phase G pyroblast Fluffy_Pillow 990544.5/1155000: 86% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), maddening_whispers(8), potion_of_deadly_grace
0:02.066 combustion_phase H fire_blast Fluffy_Pillow 980089.0/1155000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(3), maddening_whispers(7), potion_of_deadly_grace
0:02.066 combustion_phase G pyroblast Fluffy_Pillow 969089.0/1155000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), maddening_whispers(6), potion_of_deadly_grace
0:03.099 combustion_phase H fire_blast Fluffy_Pillow 958633.5/1155000: 83% mana bloodlust, combustion, heating_up, pyretic_incantation(5), maddening_whispers(5), potion_of_deadly_grace
0:03.099 combustion_phase G pyroblast Fluffy_Pillow 947633.5/1155000: 82% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), maddening_whispers(4), potion_of_deadly_grace
0:04.131 combustion_phase H fire_blast Fluffy_Pillow 937161.5/1155000: 81% mana bloodlust, combustion, heating_up, pyretic_incantation(5), maddening_whispers(3), potion_of_deadly_grace
0:04.131 combustion_phase G pyroblast Fluffy_Pillow 926161.5/1155000: 80% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), maddening_whispers(2), potion_of_deadly_grace
0:05.164 combustion_phase I phoenixs_flames Fluffy_Pillow 915706.0/1155000: 79% mana bloodlust, combustion, heating_up, pyretic_incantation(5), maddening_whispers, potion_of_deadly_grace
0:06.198 combustion_phase G pyroblast Fluffy_Pillow 932767.0/1155000: 81% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:07.230 combustion_phase I phoenixs_flames Fluffy_Pillow 922295.0/1155000: 80% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:08.263 combustion_phase G pyroblast Fluffy_Pillow 939339.5/1155000: 81% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:09.295 combustion_phase H fire_blast Fluffy_Pillow 928867.5/1155000: 80% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:09.295 combustion_phase G pyroblast Fluffy_Pillow 917867.5/1155000: 79% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:10.328 standard_rotation S fireball Fluffy_Pillow 907412.0/1155000: 79% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:11.736 standard_rotation S fireball Fluffy_Pillow 908644.0/1155000: 79% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:13.143 standard_rotation S fireball Fluffy_Pillow 909859.5/1155000: 79% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:14.551 standard_rotation S fireball Fluffy_Pillow 911091.5/1155000: 79% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
0:15.959 standard_rotation S fireball Fluffy_Pillow 912323.5/1155000: 79% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:17.367 standard_rotation Q fire_blast Fluffy_Pillow 913555.5/1155000: 79% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
0:17.367 standard_rotation M pyroblast Fluffy_Pillow 902555.5/1155000: 78% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:18.398 standard_rotation S fireball Fluffy_Pillow 892067.0/1155000: 77% mana bloodlust, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:19.806 standard_rotation M pyroblast Fluffy_Pillow 893299.0/1155000: 77% mana bloodlust, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:20.837 standard_rotation R phoenixs_flames Fluffy_Pillow 882810.5/1155000: 76% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:21.872 standard_rotation S fireball Fluffy_Pillow 899888.0/1155000: 78% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
0:23.282 standard_rotation Q fire_blast Fluffy_Pillow 901153.0/1155000: 78% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:23.282 standard_rotation M pyroblast Fluffy_Pillow 890153.0/1155000: 77% mana bloodlust, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
0:24.315 standard_rotation S fireball Fluffy_Pillow 879697.5/1155000: 76% mana bloodlust, heating_up
0:25.723 standard_rotation S fireball Fluffy_Pillow 880929.5/1155000: 76% mana bloodlust, heating_up
0:27.129 standard_rotation M pyroblast Fluffy_Pillow 882128.5/1155000: 76% mana bloodlust, hot_streak, pyretic_incantation
0:28.161 standard_rotation S fireball Fluffy_Pillow 871656.5/1155000: 75% mana bloodlust, heating_up
0:29.569 standard_rotation Q fire_blast Fluffy_Pillow 872888.5/1155000: 76% mana bloodlust, heating_up
0:29.569 standard_rotation M pyroblast Fluffy_Pillow 861888.5/1155000: 75% mana bloodlust, hot_streak, pyretic_incantation
0:30.601 standard_rotation S fireball Fluffy_Pillow 851416.5/1155000: 74% mana bloodlust, heating_up
0:32.008 standard_rotation S fireball Fluffy_Pillow 852632.0/1155000: 74% mana bloodlust, heating_up
0:33.416 standard_rotation S fireball Fluffy_Pillow 853864.0/1155000: 74% mana bloodlust, enhanced_pyrotechnics
0:34.824 standard_rotation S fireball Fluffy_Pillow 855096.0/1155000: 74% mana bloodlust, enhanced_pyrotechnics(2)
0:36.234 standard_rotation Q fire_blast Fluffy_Pillow 856361.0/1155000: 74% mana bloodlust, heating_up, pyretic_incantation
0:36.352 standard_rotation M pyroblast Fluffy_Pillow 847308.0/1155000: 73% mana bloodlust, hot_streak, pyretic_incantation(2)
0:37.384 standard_rotation S fireball Fluffy_Pillow 836836.0/1155000: 72% mana bloodlust, hot_streak, pyretic_incantation(4)
0:38.792 standard_rotation M pyroblast Fluffy_Pillow 838068.0/1155000: 73% mana bloodlust, hot_streak, pyretic_incantation(4)
0:39.823 standard_rotation S fireball Fluffy_Pillow 827579.5/1155000: 72% mana bloodlust, enhanced_pyrotechnics
0:41.230 standard_rotation S fireball Fluffy_Pillow 828795.0/1155000: 72% mana enhanced_pyrotechnics
0:43.058 standard_rotation S fireball Fluffy_Pillow 836957.0/1155000: 72% mana heating_up, pyretic_incantation
0:44.886 standard_rotation M pyroblast Fluffy_Pillow 845119.0/1155000: 73% mana hot_streak, pyretic_incantation(2)
0:46.228 standard_rotation Q fire_blast Fluffy_Pillow 839762.0/1155000: 73% mana heating_up
0:46.228 standard_rotation S fireball Fluffy_Pillow 828762.0/1155000: 72% mana hot_streak, pyretic_incantation
0:48.055 standard_rotation M pyroblast Fluffy_Pillow 836907.5/1155000: 72% mana hot_streak, pyretic_incantation
0:49.395 standard_rotation S fireball Fluffy_Pillow 831517.5/1155000: 72% mana enhanced_pyrotechnics
0:51.223 standard_rotation R phoenixs_flames Fluffy_Pillow 839679.5/1155000: 73% mana enhanced_pyrotechnics
0:52.564 standard_rotation M pyroblast Fluffy_Pillow 861806.0/1155000: 75% mana hot_streak, pyretic_incantation(2)
0:53.905 standard_rotation S fireball Fluffy_Pillow 856432.5/1155000: 74% mana
0:55.734 standard_rotation S fireball Fluffy_Pillow 864611.0/1155000: 75% mana
0:57.563 standard_rotation Q fire_blast Fluffy_Pillow 872789.5/1155000: 76% mana heating_up, pyretic_incantation
0:57.563 standard_rotation M pyroblast Fluffy_Pillow 861789.5/1155000: 75% mana hot_streak, pyretic_incantation(2)
0:58.906 standard_rotation S fireball Fluffy_Pillow 856449.0/1155000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:00.734 standard_rotation S fireball Fluffy_Pillow 864611.0/1155000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:02.563 standard_rotation M pyroblast Fluffy_Pillow 872789.5/1155000: 76% mana hot_streak, pyretic_incantation(2)
1:03.905 standard_rotation S fireball Fluffy_Pillow 867432.5/1155000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:05.734 standard_rotation S fireball Fluffy_Pillow 875611.0/1155000: 76% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:07.562 standard_rotation S fireball Fluffy_Pillow 883773.0/1155000: 77% mana enhanced_pyrotechnics(2)
1:09.390 standard_rotation S fireball Fluffy_Pillow 891935.0/1155000: 77% mana heating_up, pyretic_incantation
1:11.218 standard_rotation S fireball Fluffy_Pillow 900097.0/1155000: 78% mana enhanced_pyrotechnics
1:13.047 standard_rotation S fireball Fluffy_Pillow 908275.5/1155000: 79% mana heating_up, pyretic_incantation
1:14.876 standard_rotation S fireball Fluffy_Pillow 916454.0/1155000: 79% mana enhanced_pyrotechnics
1:16.704 standard_rotation S fireball Fluffy_Pillow 924616.0/1155000: 80% mana enhanced_pyrotechnics(2)
1:18.532 standard_rotation S fireball Fluffy_Pillow 932778.0/1155000: 81% mana enhanced_pyrotechnics(3)
1:20.362 default 7 time_warp Fluffy_Pillow 940973.0/1155000: 81% mana heating_up, pyretic_incantation
1:20.362 combustion_phase C combustion Fluffy_Pillow 896973.0/1155000: 78% mana bloodlust, heating_up, pyretic_incantation
1:20.362 combustion_phase D potion Fluffy_Pillow 786973.0/1155000: 68% mana bloodlust, combustion, heating_up, pyretic_incantation
1:20.362 combustion_phase H fire_blast Fluffy_Pillow 786973.0/1155000: 68% mana bloodlust, combustion, heating_up, pyretic_incantation, potion_of_deadly_grace
1:20.362 combustion_phase G pyroblast Fluffy_Pillow 775973.0/1155000: 67% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:21.396 combustion_phase H fire_blast Fluffy_Pillow 765534.0/1155000: 66% mana bloodlust, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:21.396 combustion_phase G pyroblast Fluffy_Pillow 754534.0/1155000: 65% mana bloodlust, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:22.430 combustion_phase H fire_blast Fluffy_Pillow 744095.0/1155000: 64% mana bloodlust, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:22.430 combustion_phase G pyroblast Fluffy_Pillow 733095.0/1155000: 63% mana bloodlust, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:23.462 combustion_phase I phoenixs_flames Fluffy_Pillow 722623.0/1155000: 63% mana bloodlust, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:24.493 combustion_phase G pyroblast Fluffy_Pillow 739634.5/1155000: 64% mana bloodlust, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:25.525 combustion_phase J scorch Fluffy_Pillow 729162.5/1155000: 63% mana bloodlust, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:26.558 combustion_phase G pyroblast Fluffy_Pillow 735207.0/1155000: 64% mana bloodlust, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:27.590 combustion_phase H fire_blast Fluffy_Pillow 724735.0/1155000: 63% mana bloodlust, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:27.590 combustion_phase G pyroblast Fluffy_Pillow 713735.0/1155000: 62% mana bloodlust, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:28.622 combustion_phase J scorch Fluffy_Pillow 703263.0/1155000: 61% mana bloodlust, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:29.653 combustion_phase G pyroblast Fluffy_Pillow 709274.5/1155000: 61% mana bloodlust, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:30.687 standard_rotation R phoenixs_flames Fluffy_Pillow 698835.5/1155000: 61% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:31.720 standard_rotation M pyroblast Fluffy_Pillow 715880.0/1155000: 62% mana bloodlust, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:32.753 standard_rotation S fireball Fluffy_Pillow 705424.5/1155000: 61% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:34.162 standard_rotation Q fire_blast Fluffy_Pillow 706673.0/1155000: 61% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:34.162 standard_rotation M pyroblast Fluffy_Pillow 695673.0/1155000: 60% mana bloodlust, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:35.194 standard_rotation S fireball Fluffy_Pillow 685201.0/1155000: 59% mana bloodlust, enhanced_pyrotechnics(2), heating_up, pyretic_incantation, potion_of_deadly_grace
1:36.603 standard_rotation S fireball Fluffy_Pillow 686449.5/1155000: 59% mana bloodlust, enhanced_pyrotechnics(2), heating_up, pyretic_incantation, potion_of_deadly_grace
1:38.012 standard_rotation S fireball Fluffy_Pillow 687698.0/1155000: 60% mana bloodlust, enhanced_pyrotechnics(3), potion_of_deadly_grace
1:39.420 standard_rotation S fireball Fluffy_Pillow 688930.0/1155000: 60% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
1:40.828 standard_rotation S fireball Fluffy_Pillow 690162.0/1155000: 60% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
1:42.235 standard_rotation Q fire_blast Fluffy_Pillow 691377.5/1155000: 60% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
1:42.235 standard_rotation M pyroblast Fluffy_Pillow 680377.5/1155000: 59% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:43.267 standard_rotation S fireball Fluffy_Pillow 669905.5/1155000: 58% mana bloodlust, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:44.674 standard_rotation M pyroblast Fluffy_Pillow 671121.0/1155000: 58% mana bloodlust, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:45.707 standard_rotation S fireball Fluffy_Pillow 660665.5/1155000: 57% mana bloodlust, hot_streak, pyretic_incantation(5)
1:47.117 standard_rotation M pyroblast Fluffy_Pillow 661930.5/1155000: 57% mana bloodlust, hot_streak, pyretic_incantation(5)
1:48.151 standard_rotation R phoenixs_flames Fluffy_Pillow 651491.5/1155000: 56% mana bloodlust, enhanced_pyrotechnics
1:49.182 standard_rotation Q fire_blast Fluffy_Pillow 668503.0/1155000: 58% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
1:49.182 standard_rotation M pyroblast Fluffy_Pillow 657503.0/1155000: 57% mana bloodlust, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
1:50.217 standard_rotation S fireball Fluffy_Pillow 647080.5/1155000: 56% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
1:51.625 standard_rotation S fireball Fluffy_Pillow 648312.5/1155000: 56% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
1:53.034 standard_rotation S fireball Fluffy_Pillow 649561.0/1155000: 56% mana bloodlust, enhanced_pyrotechnics(2)
1:54.443 standard_rotation Q fire_blast Fluffy_Pillow 650809.5/1155000: 56% mana bloodlust, heating_up, pyretic_incantation
1:54.648 standard_rotation M pyroblast Fluffy_Pillow 643192.0/1155000: 56% mana bloodlust, hot_streak, pyretic_incantation(2)
1:55.680 standard_rotation S fireball Fluffy_Pillow 632720.0/1155000: 55% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
1:57.090 standard_rotation S fireball Fluffy_Pillow 633985.0/1155000: 55% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
1:58.500 standard_rotation M pyroblast Fluffy_Pillow 635250.0/1155000: 55% mana bloodlust, hot_streak, pyretic_incantation(2)
1:59.532 standard_rotation S fireball Fluffy_Pillow 624778.0/1155000: 54% mana bloodlust, heating_up
2:00.939 standard_rotation S fireball Fluffy_Pillow 625993.5/1155000: 54% mana heating_up
2:02.768 standard_rotation S fireball Fluffy_Pillow 634172.0/1155000: 55% mana enhanced_pyrotechnics
2:04.596 standard_rotation S fireball Fluffy_Pillow 642334.0/1155000: 56% mana enhanced_pyrotechnics(2)
2:06.424 standard_rotation S fireball Fluffy_Pillow 650496.0/1155000: 56% mana enhanced_pyrotechnics(3)
2:08.252 standard_rotation S fireball Fluffy_Pillow 658658.0/1155000: 57% mana enhanced_pyrotechnics(4)
2:10.080 standard_rotation Q fire_blast Fluffy_Pillow 666820.0/1155000: 58% mana heating_up, pyretic_incantation
2:10.080 standard_rotation M pyroblast Fluffy_Pillow 655820.0/1155000: 57% mana hot_streak, pyretic_incantation(2)
2:11.422 standard_rotation Q fire_blast Fluffy_Pillow 650463.0/1155000: 56% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:11.422 standard_rotation S fireball Fluffy_Pillow 639463.0/1155000: 55% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
2:13.249 standard_rotation M pyroblast Fluffy_Pillow 647608.5/1155000: 56% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
2:14.590 standard_rotation S fireball Fluffy_Pillow 642235.0/1155000: 56% mana hot_streak, pyretic_incantation(4)
2:16.419 standard_rotation M pyroblast Fluffy_Pillow 650413.5/1155000: 56% mana hot_streak, pyretic_incantation(4)
2:17.759 standard_rotation S fireball Fluffy_Pillow 645023.5/1155000: 56% mana hot_streak, pyretic_incantation(5)
2:19.588 standard_rotation M pyroblast Fluffy_Pillow 653202.0/1155000: 57% mana hot_streak, pyretic_incantation(5)
2:20.929 standard_rotation S fireball Fluffy_Pillow 647828.5/1155000: 56% mana hot_streak, pyretic_incantation(5)
2:22.759 standard_rotation M pyroblast Fluffy_Pillow 656023.5/1155000: 57% mana hot_streak, pyretic_incantation(5)
2:24.100 standard_rotation S fireball Fluffy_Pillow 650650.0/1155000: 56% mana hot_streak, pyretic_incantation(5)
2:25.928 standard_rotation M pyroblast Fluffy_Pillow 658812.0/1155000: 57% mana hot_streak, pyretic_incantation(5)
2:27.269 standard_rotation S fireball Fluffy_Pillow 653438.5/1155000: 57% mana hot_streak, pyretic_incantation(5)
2:29.098 standard_rotation M pyroblast Fluffy_Pillow 661617.0/1155000: 57% mana hot_streak, pyretic_incantation(5)
2:30.441 standard_rotation S fireball Fluffy_Pillow 656276.5/1155000: 57% mana hot_streak, pyretic_incantation(5)
2:32.267 standard_rotation M pyroblast Fluffy_Pillow 664405.5/1155000: 58% mana hot_streak, pyretic_incantation(5)
2:33.609 standard_rotation S fireball Fluffy_Pillow 659048.5/1155000: 57% mana enhanced_pyrotechnics
2:35.437 standard_rotation S fireball Fluffy_Pillow 667210.5/1155000: 58% mana enhanced_pyrotechnics
2:37.265 combustion_phase C combustion Fluffy_Pillow 675372.5/1155000: 58% mana heating_up, pyretic_incantation
2:37.265 combustion_phase E use_item_wriggling_sinew Fluffy_Pillow 565372.5/1155000: 49% mana combustion, heating_up, pyretic_incantation
2:37.265 combustion_phase H fire_blast Fluffy_Pillow 565372.5/1155000: 49% mana combustion, heating_up, pyretic_incantation, maddening_whispers(10)
2:37.265 combustion_phase G pyroblast Fluffy_Pillow 554372.5/1155000: 48% mana combustion, hot_streak, pyretic_incantation(2), maddening_whispers(9)
2:38.606 combustion_phase G pyroblast Fluffy_Pillow 548999.0/1155000: 48% mana combustion, hot_streak, pyretic_incantation(4), maddening_whispers(7)
2:39.946 combustion_phase H fire_blast Fluffy_Pillow 543609.0/1155000: 47% mana combustion, heating_up, pyretic_incantation(5), maddening_whispers(6)
2:39.946 combustion_phase G pyroblast Fluffy_Pillow 532609.0/1155000: 46% mana combustion, hot_streak, pyretic_incantation(5), maddening_whispers(5)
2:41.286 combustion_phase H fire_blast Fluffy_Pillow 527219.0/1155000: 46% mana combustion, heating_up, pyretic_incantation(5), maddening_whispers(4)
2:41.286 combustion_phase G pyroblast Fluffy_Pillow 516219.0/1155000: 45% mana combustion, hot_streak, pyretic_incantation(5), maddening_whispers(3)
2:42.627 combustion_phase I phoenixs_flames Fluffy_Pillow 510845.5/1155000: 44% mana combustion, heating_up, pyretic_incantation(5), maddening_whispers(2)
2:43.968 combustion_phase G pyroblast Fluffy_Pillow 532972.0/1155000: 46% mana combustion, hot_streak, pyretic_incantation(5), maddening_whispers
2:45.309 combustion_phase I phoenixs_flames Fluffy_Pillow 527598.5/1155000: 46% mana combustion, heating_up, pyretic_incantation(5)
2:46.651 combustion_phase G pyroblast Fluffy_Pillow 549741.5/1155000: 48% mana combustion, hot_streak, pyretic_incantation(5)
2:47.993 standard_rotation Q fire_blast Fluffy_Pillow 544384.5/1155000: 47% mana heating_up, pyretic_incantation(5)
2:47.993 standard_rotation S fireball Fluffy_Pillow 533384.5/1155000: 46% mana hot_streak, pyretic_incantation(5)
2:49.822 standard_rotation M pyroblast Fluffy_Pillow 541563.0/1155000: 47% mana hot_streak, pyretic_incantation(5)
2:51.164 standard_rotation S fireball Fluffy_Pillow 536206.0/1155000: 46% mana enhanced_pyrotechnics
2:52.993 standard_rotation S fireball Fluffy_Pillow 544384.5/1155000: 47% mana enhanced_pyrotechnics
2:54.821 standard_rotation S fireball Fluffy_Pillow 552546.5/1155000: 48% mana heating_up, pyretic_incantation
2:56.649 standard_rotation M pyroblast Fluffy_Pillow 560708.5/1155000: 49% mana hot_streak, pyretic_incantation(2)
2:57.988 standard_rotation Q fire_blast Fluffy_Pillow 555302.0/1155000: 48% mana heating_up
2:57.988 standard_rotation S fireball Fluffy_Pillow 544302.0/1155000: 47% mana hot_streak, pyretic_incantation
2:59.818 standard_rotation M pyroblast Fluffy_Pillow 552497.0/1155000: 48% mana hot_streak, pyretic_incantation
3:01.161 standard_rotation R phoenixs_flames Fluffy_Pillow 547156.5/1155000: 47% mana hot_streak, pyretic_incantation(3)
3:02.502 standard_rotation M pyroblast Fluffy_Pillow 569283.0/1155000: 49% mana hot_streak, pyretic_incantation(4)
3:03.843 standard_rotation N pyroblast Fluffy_Pillow 563909.5/1155000: 49% mana kaelthas_ultimate_ability
3:07.859 standard_rotation S fireball Fluffy_Pillow 602673.5/1155000: 52% mana
3:09.688 standard_rotation S fireball Fluffy_Pillow 610852.0/1155000: 53% mana
3:11.517 standard_rotation S fireball Fluffy_Pillow 619030.5/1155000: 54% mana enhanced_pyrotechnics
3:13.344 standard_rotation Q fire_blast Fluffy_Pillow 627176.0/1155000: 54% mana heating_up, pyretic_incantation
3:13.344 standard_rotation M pyroblast Fluffy_Pillow 616176.0/1155000: 53% mana hot_streak, pyretic_incantation(2)
3:14.685 standard_rotation S fireball Fluffy_Pillow 610802.5/1155000: 53% mana enhanced_pyrotechnics
3:16.512 standard_rotation S fireball Fluffy_Pillow 618948.0/1155000: 54% mana enhanced_pyrotechnics
3:18.340 standard_rotation S fireball Fluffy_Pillow 627110.0/1155000: 54% mana enhanced_pyrotechnics(2)
3:20.169 standard_rotation S fireball Fluffy_Pillow 635288.5/1155000: 55% mana enhanced_pyrotechnics(3)
3:21.996 standard_rotation Q fire_blast Fluffy_Pillow 643434.0/1155000: 56% mana heating_up, pyretic_incantation
3:21.996 standard_rotation M pyroblast Fluffy_Pillow 632434.0/1155000: 55% mana hot_streak, pyretic_incantation(2)
3:23.340 standard_rotation S fireball Fluffy_Pillow 627110.0/1155000: 54% mana hot_streak, pyretic_incantation(4)
3:25.169 standard_rotation M pyroblast Fluffy_Pillow 635288.5/1155000: 55% mana hot_streak, pyretic_incantation(4)
3:26.510 standard_rotation Q fire_blast Fluffy_Pillow 629915.0/1155000: 55% mana heating_up
3:26.510 standard_rotation S fireball Fluffy_Pillow 618915.0/1155000: 54% mana hot_streak, pyretic_incantation
3:28.340 standard_rotation M pyroblast Fluffy_Pillow 627110.0/1155000: 54% mana hot_streak, pyretic_incantation
3:29.682 standard_rotation S fireball Fluffy_Pillow 621753.0/1155000: 54% mana heating_up
3:31.510 standard_rotation Q fire_blast Fluffy_Pillow 629915.0/1155000: 55% mana heating_up
3:31.510 standard_rotation M pyroblast Fluffy_Pillow 618915.0/1155000: 54% mana hot_streak, pyretic_incantation
3:32.853 standard_rotation N pyroblast Fluffy_Pillow 613574.5/1155000: 53% mana heating_up, kaelthas_ultimate_ability
3:36.869 standard_rotation S fireball Fluffy_Pillow 652338.5/1155000: 56% mana heating_up
3:38.697 standard_rotation M pyroblast Fluffy_Pillow 660500.5/1155000: 57% mana hot_streak, pyretic_incantation
3:40.038 standard_rotation N pyroblast Fluffy_Pillow 655127.0/1155000: 57% mana hot_streak, pyretic_incantation(3), kaelthas_ultimate_ability
3:41.380 standard_rotation N pyroblast Fluffy_Pillow 649770.0/1155000: 56% mana kaelthas_ultimate_ability
3:45.396 standard_rotation S fireball Fluffy_Pillow 688534.0/1155000: 60% mana
3:47.225 standard_rotation S fireball Fluffy_Pillow 696712.5/1155000: 60% mana
3:49.054 standard_rotation S fireball Fluffy_Pillow 704891.0/1155000: 61% mana enhanced_pyrotechnics
3:50.882 standard_rotation S fireball Fluffy_Pillow 713053.0/1155000: 62% mana enhanced_pyrotechnics(2)
3:52.712 standard_rotation Q fire_blast Fluffy_Pillow 721248.0/1155000: 62% mana heating_up, pyretic_incantation
3:52.712 standard_rotation M pyroblast Fluffy_Pillow 710248.0/1155000: 61% mana hot_streak, pyretic_incantation(2)
3:54.054 standard_rotation S fireball Fluffy_Pillow 704891.0/1155000: 61% mana enhanced_pyrotechnics
3:55.883 standard_rotation S fireball Fluffy_Pillow 713069.5/1155000: 62% mana enhanced_pyrotechnics
3:57.710 standard_rotation S fireball Fluffy_Pillow 721215.0/1155000: 62% mana heating_up, pyretic_incantation
3:59.537 standard_rotation M pyroblast Fluffy_Pillow 729360.5/1155000: 63% mana hot_streak, pyretic_incantation(2)
4:00.878 standard_rotation S fireball Fluffy_Pillow 723987.0/1155000: 63% mana enhanced_pyrotechnics
4:02.707 combustion_phase C combustion Fluffy_Pillow 732165.5/1155000: 63% mana enhanced_pyrotechnics
4:02.707 combustion_phase I phoenixs_flames Fluffy_Pillow 622165.5/1155000: 54% mana combustion, enhanced_pyrotechnics
4:04.049 combustion_phase G pyroblast Fluffy_Pillow 644308.5/1155000: 56% mana combustion, hot_streak, pyretic_incantation(2)
4:05.390 combustion_phase H fire_blast Fluffy_Pillow 638935.0/1155000: 55% mana combustion, heating_up, pyretic_incantation(3)
4:05.390 combustion_phase G pyroblast Fluffy_Pillow 627935.0/1155000: 54% mana combustion, hot_streak, pyretic_incantation(4)
4:06.732 combustion_phase H fire_blast Fluffy_Pillow 622578.0/1155000: 54% mana combustion, heating_up, pyretic_incantation(5)
4:06.732 combustion_phase G pyroblast Fluffy_Pillow 611578.0/1155000: 53% mana combustion, hot_streak, pyretic_incantation(5)
4:08.073 combustion_phase H fire_blast Fluffy_Pillow 606204.5/1155000: 52% mana combustion, heating_up, pyretic_incantation(5)
4:08.073 combustion_phase G pyroblast Fluffy_Pillow 595204.5/1155000: 52% mana combustion, hot_streak, pyretic_incantation(5)
4:09.414 combustion_phase J scorch Fluffy_Pillow 589831.0/1155000: 51% mana combustion, heating_up, pyretic_incantation(5)
4:10.756 combustion_phase G pyroblast Fluffy_Pillow 600974.0/1155000: 52% mana combustion, hot_streak, pyretic_incantation(5)
4:12.098 combustion_phase I phoenixs_flames Fluffy_Pillow 595617.0/1155000: 52% mana combustion, heating_up, pyretic_incantation(5)
4:13.440 standard_rotation M pyroblast Fluffy_Pillow 617760.0/1155000: 53% mana hot_streak, pyretic_incantation(5)
4:14.781 standard_rotation S fireball Fluffy_Pillow 612386.5/1155000: 53% mana heating_up, pyretic_incantation(5)
4:16.608 standard_rotation Q fire_blast Fluffy_Pillow 620532.0/1155000: 54% mana heating_up, pyretic_incantation(5)
4:16.608 standard_rotation M pyroblast Fluffy_Pillow 609532.0/1155000: 53% mana hot_streak, pyretic_incantation(5)
4:17.950 standard_rotation S fireball Fluffy_Pillow 604175.0/1155000: 52% mana enhanced_pyrotechnics
4:19.778 standard_rotation S fireball Fluffy_Pillow 612337.0/1155000: 53% mana enhanced_pyrotechnics
4:21.607 standard_rotation S fireball Fluffy_Pillow 620515.5/1155000: 54% mana heating_up, pyretic_incantation
4:23.436 standard_rotation S fireball Fluffy_Pillow 628694.0/1155000: 54% mana enhanced_pyrotechnics
4:25.265 standard_rotation Q fire_blast Fluffy_Pillow 636872.5/1155000: 55% mana heating_up, pyretic_incantation
4:25.265 standard_rotation M pyroblast Fluffy_Pillow 625872.5/1155000: 54% mana hot_streak, pyretic_incantation(2)
4:26.607 standard_rotation S fireball Fluffy_Pillow 620515.5/1155000: 54% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:28.437 standard_rotation S fireball Fluffy_Pillow 628710.5/1155000: 54% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:30.264 standard_rotation M pyroblast Fluffy_Pillow 636856.0/1155000: 55% mana hot_streak, pyretic_incantation(2)
4:31.605 standard_rotation S fireball Fluffy_Pillow 631482.5/1155000: 55% mana hot_streak, pyretic_incantation(4)
4:33.431 standard_rotation M pyroblast Fluffy_Pillow 639611.5/1155000: 55% mana hot_streak, pyretic_incantation(4)
4:34.773 standard_rotation S fireball Fluffy_Pillow 634254.5/1155000: 55% mana hot_streak, pyretic_incantation(5)
4:36.601 standard_rotation M pyroblast Fluffy_Pillow 642416.5/1155000: 56% mana hot_streak, pyretic_incantation(5)
4:37.942 standard_rotation N pyroblast Fluffy_Pillow 637043.0/1155000: 55% mana hot_streak, pyretic_incantation(5), kaelthas_ultimate_ability
4:39.285 standard_rotation N pyroblast Fluffy_Pillow 631702.5/1155000: 55% mana kaelthas_ultimate_ability
4:43.301 standard_rotation S fireball Fluffy_Pillow 670466.5/1155000: 58% mana
4:45.129 standard_rotation Q fire_blast Fluffy_Pillow 678628.5/1155000: 59% mana heating_up, pyretic_incantation
4:45.129 standard_rotation M pyroblast Fluffy_Pillow 667628.5/1155000: 58% mana hot_streak, pyretic_incantation(2)
4:46.470 standard_rotation Q fire_blast Fluffy_Pillow 662255.0/1155000: 57% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:46.470 standard_rotation S fireball Fluffy_Pillow 651255.0/1155000: 56% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:48.299 standard_rotation M pyroblast Fluffy_Pillow 659433.5/1155000: 57% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:49.642 standard_rotation R phoenixs_flames Fluffy_Pillow 654093.0/1155000: 57% mana enhanced_pyrotechnics(2)
4:50.982 standard_rotation Q fire_blast Fluffy_Pillow 676203.0/1155000: 59% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
4:51.232 standard_rotation M pyroblast Fluffy_Pillow 669328.0/1155000: 58% mana enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(2)
4:52.574 standard_rotation S fireball Fluffy_Pillow 663971.0/1155000: 57% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation(3)
4:54.405 standard_rotation S fireball Fluffy_Pillow 672182.5/1155000: 58% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation(3)
4:56.234 standard_rotation S fireball Fluffy_Pillow 680361.0/1155000: 59% mana enhanced_pyrotechnics(3)
4:58.063 standard_rotation R phoenixs_flames Fluffy_Pillow 688539.5/1155000: 60% mana heating_up, pyretic_incantation
4:59.404 standard_rotation M pyroblast Fluffy_Pillow 710666.0/1155000: 62% mana hot_streak, pyretic_incantation(3)
5:00.744 default 7 time_warp Fluffy_Pillow 705276.0/1155000: 61% mana
5:00.744 standard_rotation P fire_blast Fluffy_Pillow 661276.0/1155000: 57% mana bloodlust
5:00.744 standard_rotation S fireball Fluffy_Pillow 650276.0/1155000: 56% mana bloodlust, heating_up, pyretic_incantation
5:02.153 standard_rotation S fireball Fluffy_Pillow 651524.5/1155000: 56% mana bloodlust, heating_up, pyretic_incantation
5:03.561 standard_rotation S fireball Fluffy_Pillow 652756.5/1155000: 57% mana bloodlust, enhanced_pyrotechnics

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4870 4545 0
Agility 6579 6254 0
Stamina 45630 45630 26927
Intellect 36497 34791 25804 (967)
Spirit 0 0 0
Health 2737800 2737800 0
Mana 1155000 1155000 0
Spell Power 36497 34791 0
Melee Crit 34.90% 33.97% 11587
Spell Crit 52.90% 51.86% 12746
Haste 12.17% 12.17% 4146
Damage / Heal Versatility 2.72% 2.72% 1290
ManaReg per Second 16500 16500 0
Mastery 17.31% 17.31% 6033
Armor 1803 1803 1803
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Hood of Darkened Visions
ilevel: 865, stats: { 223 Armor, +2348 Sta, +1566 Int, +880 Crit, +569 Mastery }
Local Neck Beleron's Choker of Misery
ilevel: 880, stats: { +1519 Sta, +1484 Crit, +1114 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 885, stats: { 221 Armor, +2122 Sta, +1415 Int, +686 Mastery, +485 Crit }
Local Shirt Precious' Ribbon
ilevel: 1
Local Chest Dreamscale Inlaid Vestments
ilevel: 875, stats: { 284 Armor, +2577 Sta, +1719 Int, +946 Haste, +559 Mastery }
Local Waist Cinch of Light
ilevel: 875, stats: { 160 Armor, +1933 Sta, +1289 Int, +806 Mastery, +322 Haste }
Local Legs Leggings of the Lower Planes
ilevel: 875, stats: { 249 Armor, +2577 Sta, +1719 Int, +1042 Crit, +462 Haste }
Local Feet Crimson Wool-Lined Slippers
ilevel: 880, stats: { 199 Armor, +2026 Sta, +1351 Int, +723 Crit, +427 Mastery }
Local Wrists Marquee Bindings of the Sun King
ilevel: 910, stats: { 141 Armor, +2010 Sta, +1340 Int, +620 Crit, +344 Haste }
Local Hands Oiled Rigger's Handwraps
ilevel: 885, stats: { 184 Armor, +2123 Sta, +1415 Int, +761 Crit, +410 Vers }
Local Finger1 Band of the Wyrm Matron
ilevel: 865, stats: { +1321 Sta, +1490 Crit, +880 Vers }, enchant: { +200 Crit }
Local Finger2 Shard of the Exodar
ilevel: 910, stats: { +2010 Sta, +2004 Crit, +1114 Haste }, gems: { +200 Int }, enchant: { +200 Crit }
Local Trinket1 Wriggling Sinew
ilevel: 875, stats: { +1075 Crit }
Local Trinket2 Bough of Corruption
ilevel: 865, stats: { +1036 Mastery }
Local Back Drape of the Forgotten Souls
ilevel: 875, stats: { 142 Armor, +967 StrAgiInt, +1450 Sta, +496 Mastery, +350 Crit }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 889, weapon: { 2369 - 4402, 2.6 }, stats: { +839 Int, +1259 Sta, +340 Haste, +340 Mastery, +10683 Int }, relics: { +46 ilevels, +48 ilevels, +45 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 889, stats: { +1101 Int, +1652 Sta, +618 Haste, +273 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Blast Wave (Fire Mage) Blazing Soul (Fire Mage)
45 Mirror Image Rune of Power Incanter's Flow
60 Alexstrasza's Fury (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Frenetic Speed (Fire Mage) Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Lâstykökö"
origin="https://eu.api.battle.net/wow/character/hyjal/Lâstykökö/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/105/115117161-avatar.jpg"
level=110
race=gnome
role=spell
position=back
professions=tailoring=800/enchanting=696
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eZ!1021010
artifact=54:0:0:0:0:748:1:749:3:750:3:751:3:752:3:753:3:754:3:755:3:756:3:757:3:758:1:759:1:760:1:761:1:762:1:763:1:1340:1:1372:10
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410&(cooldown.combustion.remains<1|target.time_to_die.remains<50))
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=standard_rotation

actions.active_talents=blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>15|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863|(talent.alexstraszas_fury.enabled&buff.hot_streak.down)
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/use_item,slot=trinket1
actions.combustion_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react&buff.combustion.remains>execute_time
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/dragons_breath,if=buff.hot_streak.down&action.fire_blast.charges<1&action.phoenixs_flames.charges<1
actions.combustion_phase+=/scorch,if=target.health.pct<=30&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/flamestrike,if=((talent.flame_patch.enabled&active_enemies>1)|(active_enemies>3))&buff.hot_streak.up
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react&execute_time<buff.kaelthas_ultimate_ability.remains
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.1.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=30&equipped.132454
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/flamestrike,if=(talent.flame_patch.enabled&active_enemies>2)|active_enemies>5
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=((talent.flame_patch.enabled&active_enemies>1)|active_enemies>3)&buff.hot_streak.up
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.1.pyroblast
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&equipped.132454
actions.standard_rotation+=/pyroblast,if=buff.kaelthas_ultimate_ability.react&execute_time<buff.kaelthas_ultimate_ability.remains
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.standard_rotation+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.standard_rotation+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.standard_rotation+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.standard_rotation+=/flamestrike,if=(talent.flame_patch.enabled&active_enemies>1)|active_enemies>5
actions.standard_rotation+=/scorch,if=target.health.pct<=30&equipped.132454
actions.standard_rotation+=/fireball

head=hood_of_darkened_visions,id=139189,bonus_id=1805/1487
neck=belerons_choker_of_misery,id=140899,bonus_id=3514/1477/3336,enchant=mark_of_the_hidden_satyr
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1806/1507/3336
back=drape_of_the_forgotten_souls,id=142541,bonus_id=3467/1492/3337,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1805/1497/3336
shirt=precious_ribbon,id=52019
tabard=renowned_guild_tabard,id=69210
wrists=marquee_bindings_of_the_sun_king,id=132406,bonus_id=1811/3458
hands=oiled_riggers_handwraps,id=142429,bonus_id=3507/1502/3336
waist=cinch_of_light,id=142411,bonus_id=3468/1492
legs=leggings_of_the_lower_planes,id=142413,bonus_id=3468/1492
feet=crimson_woollined_slippers,id=139195,bonus_id=1806/1502
finger1=band_of_the_wyrm_matron,id=134524,bonus_id=3413/1517/3337,enchant=200crit
finger2=shard_of_the_exodar,id=132410,bonus_id=1811,gems=200int,enchant=200crit
trinket1=wriggling_sinew,id=139326,bonus_id=1805/1497/3336
trinket2=bough_of_corruption,id=139336,bonus_id=1805/1487
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=142516/139269/141261/0,relic_id=3467:1477/1805:1487/3474:1517:3336/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=881.13
# gear_stamina=26927
# gear_intellect=25804
# gear_crit_rating=11587
# gear_haste_rating=4146
# gear_mastery_rating=6033
# gear_versatility_rating=1290
# gear_armor=1803

Illaz

Illaz : 412233 dps

  • Race: Human
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
412232.8 412232.8 278.3 / 0.068% 54605.9 / 13.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 5.83% 52.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Illaz/advanced
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: Zeal (Retribution Paladin)
  • 45: Blinding Light
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Justicar's Vengeance (Retribution Paladin)
  • 90: Divine Intervention (Retribution Paladin)
  • 100: Crusade (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • alchemy: 350
  • herbalism: 796

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Illaz 412233
Blade of Justice 47237 11.5% 49.9 6.01sec 284045 261074 Direct 49.9 235053 469924 284051 20.9%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.95 49.95 0.00 0.00 1.0880 0.0000 14187823.76 20857444.83 31.98 261074.34 261074.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.53 79.14% 235053.12 197153 345758 235157.02 216177 256149 9291536 13659438 31.98
crit 10.42 20.86% 469923.80 394307 691515 469977.86 394307 623867 4896288 7198007 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<2&(equipped.137048|race.blood_elf)
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Templar's Verdict (echoed_verdict) 15538 3.8% 76.2 3.93sec 61247 0 Direct 76.2 50730 101378 61249 20.8%  

Stats details: echoed_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.21 76.21 0.00 0.00 0.0000 0.0000 4667811.26 4667811.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.39 79.23% 50729.60 29071 77694 50755.01 46210 54942 3063310 3063310 0.00
crit 15.83 20.77% 101377.73 58143 155387 101423.70 75966 130171 1604501 1604501 0.00
 
 

Action details: echoed_verdict

Static Values
  • id:224266
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:224266
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $sw1 Holy damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.40
 
Horrific Slam 8102 2.0% 82.3 2.80sec 29566 0 Direct 82.3 24462 48911 29566 20.9%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.29 82.29 0.00 0.00 0.0000 0.0000 2433117.16 2433117.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.12 79.12% 24461.53 20579 36091 24569.32 20579 33345 1592847 1592847 0.00
crit 17.18 20.88% 48911.38 41159 72182 49136.84 0 72182 840271 840271 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17354.25
  • base_dd_max:19181.01
 
Judgment 36295 8.8% 32.7 9.39sec 333322 301514 Direct 32.7 275877 551754 333465 20.9%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.72 32.70 0.00 0.00 1.1055 0.0000 10904861.49 10904861.49 0.00 301514.13 301514.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.88 79.13% 275876.93 235807 413547 275960.38 251200 305621 7138411 7138411 0.00
crit 6.83 20.87% 551753.56 471614 827094 551509.29 0 755172 3766451 3766451 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 18734 4.5% 116.6 2.57sec 48269 18753 Direct 116.6 39960 79954 48270 20.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.56 116.56 0.00 0.00 2.5739 0.0000 5626455.05 8271421.87 31.98 18753.47 18753.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.34 79.22% 39959.76 33526 58796 39979.31 38094 42420 3690057 5424733 31.98
crit 24.22 20.78% 79954.40 67051 117591 80001.43 68545 94049 1936398 2846689 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 25866 6.2% 32.9 4.77sec 232333 0 Direct 32.9 192241 384556 232335 20.8%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.93 32.93 0.00 0.00 0.0000 0.0000 7650410.98 11246828.81 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.06 79.15% 192241.02 130193 228326 192222.82 182169 203697 5010567 7366008 31.98
crit 6.86 20.85% 384556.20 260386 456653 384269.99 0 435692 2639844 3880821 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rend Flesh 4398 1.1% 18.9 15.39sec 70029 0 Periodic 68.5 15986 31910 19303 20.8% 45.6%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.89 0.00 68.52 68.52 0.0000 2.0000 1322510.86 1322510.86 0.00 9651.11 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.2 79.17% 15985.56 12509 51909 15976.59 12872 21739 867119 867119 0.00
crit 14.3 20.83% 31910.16 25018 103819 31895.09 0 51582 455392 455392 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_of_vengeance_proc 11930 2.9% 3.8 89.42sec 941211 0 Direct 3.6 817332 1634762 989039 21.0%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 3.62 0.00 0.00 0.0000 0.0000 3576958.65 3576958.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.86 79.00% 817332.49 690371 1052815 815488.36 0 1052815 2335171 2335171 0.00
crit 0.76 21.00% 1634762.15 1380741 2105631 932892.72 0 2105631 1241788 1241788 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:612832.82
  • base_dd_max:612832.82
 
Templar's Verdict 159931 38.8% 76.4 3.93sec 628820 571447 Direct 76.4 520159 1040577 628835 20.9%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.42 76.42 0.00 0.00 1.1004 0.0000 48052395.40 48052395.40 0.00 571446.86 571446.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.46 79.12% 520158.54 443014 776936 520328.16 489985 551056 31448695 31448695 0.00
crit 15.96 20.88% 1040576.75 886028 1553872 1041080.22 886028 1267752 16603700 16603700 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 23168 5.6% 10.0 31.71sec 699945 617863 Direct 10.0 263536 526975 317729 20.6%  
Periodic 59.1 53284 106543 64401 20.9% 19.6%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.95 9.95 59.06 59.06 1.1329 1.0000 6965784.23 6965784.23 0.00 99034.42 617862.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.90 79.43% 263535.80 247108 376840 263445.71 247108 304767 2083126 2083126 0.00
crit 2.05 20.57% 526975.42 494217 753680 471460.30 0 753680 1078897 1078897 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.7 79.12% 53284.18 48091 73339 53280.73 49685 57240 2490152 2490152 0.00
crit 12.3 20.88% 106542.80 96182 146677 106550.54 96182 134053 1313609 1313609 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=1&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec.][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Zeal 61034 14.8% 85.4 3.48sec 214621 196937 Direct 85.4 154525 309063 214623 38.9%  

Stats details: zeal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.42 85.42 0.00 0.00 1.0898 0.0000 18332479.39 26950481.20 31.98 196937.09 196937.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.20 61.11% 154524.83 130022 228027 154599.17 141548 166986 8066203 11858082 31.98
crit 33.22 38.89% 309063.19 260044 456053 309216.30 274967 355407 10266277 15092399 31.98
 
 

Action details: zeal

Static Values
  • id:217020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:217020
  • name:Zeal
  • school:physical
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Simple Action Stats Execute Interval
Illaz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illaz
  • harmful:false
  • if_expr:
 
Crusade 3.0 120.31sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illaz
  • harmful:false
  • if_expr:holy_power>=5&!equipped.137048|((equipped.137048|race.blood_elf)&time<2|time>2&holy_power>=4)
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s2=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illaz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illaz
  • harmful:false
  • if_expr:
 
Judgment (_aoe) 32.7 9.34sec

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<2
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rend Flesh (rending_flesh_trigger) 18.9 15.39sec

Stats details: rending_flesh_trigger

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rending_flesh_trigger

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:44415.97
  • base_dd_max:44415.97
 
Shield of Vengeance 3.8 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.80 3.80 0.00 0.00 0.0000 0.0000 0.00 2328997.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.01 79.09% 0.00 0 0 0.00 0 0 0 1841992 99.67
crit 0.79 20.91% 0.00 0 0 0.00 0 0 0 487006 59.15
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illaz
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*{$s2=20}} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade of Wrath! 24.1 7.5 12.6sec 9.5sec 30.31% 30.31% 7.5(7.5) 23.8

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_blade_of_wrath
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blade_of_wrath_1:30.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231843
  • name:Blade of Wrath!
  • tooltip:
  • description:{$@spelldesc231832=Your auto attacks have a chance to reset the cooldown of Blade of Justice.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 34.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crusade 3.0 27.8 120.3sec 8.8sec 26.10% 100.00% 16.1(42.6) 2.7

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:27.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.24%
  • crusade_4:2.61%
  • crusade_7:2.88%
  • crusade_10:2.86%
  • crusade_13:2.59%
  • crusade_15:14.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s2=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Horrific Appendages 4.6 1.0 60.3sec 47.2sec 20.86% 20.86% 83.3(83.3) 4.4

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:20.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 125.6sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shield of Vengeance 3.8 0.0 90.0sec 90.0sec 18.47% 18.47% 0.0(0.0) 3.6

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*{$s2=20}} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Zeal 1.3 84.1 152.5sec 3.5sec 98.12% 98.43% 81.5(81.5) 0.3

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_zeal
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • zeal_1:0.60%
  • zeal_2:1.03%
  • zeal_3:96.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217020
  • name:Zeal
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
blade_of_wrath 31.6 9.5sec

Resources

Resource Usage Type Count Total Average RPE APR
Illaz
templars_verdict Holy Power 76.4 229.3 3.0 3.0 209604.7
Resource Gains Type Count Total Average Overflow
blade_of_justice Holy Power 49.95 99.90 (43.08%) 2.00 0.00 0.00%
wake_of_ashes Holy Power 9.95 46.60 (20.09%) 4.68 3.16 6.35%
zeal Holy Power 85.42 85.42 (36.83%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.77 0.76
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.68 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Illaz Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Illaz Damage Per Second
Count 9999
Mean 412232.80
Minimum 364904.66
Maximum 462218.25
Spread ( max - min ) 97313.59
Range [ ( max - min ) / 2 * 100% ] 11.80%
Standard Deviation 14197.0304
5th Percentile 389364.84
95th Percentile 435639.44
( 95th Percentile - 5th Percentile ) 46274.60
Mean Distribution
Standard Deviation 141.9774
95.00% Confidence Intervall ( 411954.53 - 412511.07 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4557
0.1 Scale Factor Error with Delta=300 1720596
0.05 Scale Factor Error with Delta=300 6882381
0.01 Scale Factor Error with Delta=300 172059515
Priority Target DPS
Sample Data Illaz Priority Target Damage Per Second
Count 9999
Mean 412232.80
Minimum 364904.66
Maximum 462218.25
Spread ( max - min ) 97313.59
Range [ ( max - min ) / 2 * 100% ] 11.80%
Standard Deviation 14197.0304
5th Percentile 389364.84
95th Percentile 435639.44
( 95th Percentile - 5th Percentile ) 46274.60
Mean Distribution
Standard Deviation 141.9774
95.00% Confidence Intervall ( 411954.53 - 412511.07 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4557
0.1 Scale Factor Error with Delta=300 1720596
0.05 Scale Factor Error with Delta=300 6882381
0.01 Scale Factor Error with Delta=300 172059515
DPS(e)
Sample Data Illaz Damage Per Second (Effective)
Count 9999
Mean 412232.80
Minimum 364904.66
Maximum 462218.25
Spread ( max - min ) 97313.59
Range [ ( max - min ) / 2 * 100% ] 11.80%
Damage
Sample Data Illaz Damage
Count 9999
Mean 123720608.22
Minimum 91475661.75
Maximum 154677905.48
Spread ( max - min ) 63202243.73
Range [ ( max - min ) / 2 * 100% ] 25.54%
DTPS
Sample Data Illaz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Illaz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Illaz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Illaz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Illaz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Illaz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data IllazTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Illaz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 rebuke
6 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5&(buff.crusade.up|buff.avenging_wrath.up|time<2)
7 1.00 judgment,if=time<2
0.00 blade_of_justice,if=time<2&(equipped.137048|race.blood_elf)
0.00 divine_hammer,if=time<2&(equipped.137048|race.blood_elf)
8 1.00 wake_of_ashes,if=holy_power<=1&time<2
0.00 holy_wrath
0.00 avenging_wrath
9 3.80 shield_of_vengeance
A 3.00 crusade,if=holy_power>=5&!equipped.137048|((equipped.137048|race.blood_elf)&time<2|time>2&holy_power>=4)
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
B 20.03 templars_verdict,if=debuff.judgment.up&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
C 22.49 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
D 7.57 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
E 8.95 wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
0.00 blade_of_justice,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
0.00 divine_hammer,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
F 49.95 blade_of_justice,if=talent.blade_of_wrath.enabled&holy_power<=3
G 21.76 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4
0.00 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
0.00 divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
H 31.72 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
0.00 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
I 25.68 templars_verdict,if=debuff.judgment.up&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
J 63.66 zeal,if=holy_power<=4
0.00 crusader_strike,if=holy_power<=4
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
K 0.66 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

01245798ABFBGJBFHFBGJBFJBHJJFBJHJBFJBFJBFJHBGFDECFGCJFHCFGCJIFJFHCGIFGIJHECFGCFGHCFGCJIFJHJIJFI9JHJDECFIGHFGCJIFJHJIJFJAHB6FBEBGBFFGHBGIJFJIHJJFCJIHJFFCGHDFGDECGFHCGIJJFHIJFI9JJHIFJDECGHFCGIJJFHIJJIFJHFCJDECGFHCGIJJFHJABFBFGHBGJBEBFIGHFGCJIFJHJIJFIJH9JKFJIFJHDECFGCJHIJFIJJFHIJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Illaz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre precombat 1 food Illaz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre precombat 2 augmentation Illaz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 default 5 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 default 7 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, potion_of_the_old_war
0:00.000 default 9 shield_of_vengeance Illaz 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:00.964 default 8 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:01.928 default A crusade Illaz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:01.928 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:02.859 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:03.704 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(4), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:04.550 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(7), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:05.325 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), zeal, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:06.099 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), zeal(2), shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:06.873 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(10), zeal(2), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:07.627 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), zeal(2), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:08.427 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), zeal(2), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:09.181 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), zeal(2), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:09.936 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(2), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:10.691 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:11.446 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(13), zeal(3), blade_of_wrath, shield_of_vengeance, horrific_appendages, potion_of_the_old_war
0:12.201 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath, shield_of_vengeance, potion_of_the_old_war
0:12.954 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath, shield_of_vengeance, potion_of_the_old_war
0:13.708 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath, shield_of_vengeance, potion_of_the_old_war
0:14.462 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, potion_of_the_old_war
0:15.216 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:15.971 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:16.724 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:17.477 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:18.231 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:18.985 Waiting     0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:19.285 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:20.248 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:21.003 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:21.756 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:22.510 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), potion_of_the_old_war
0:23.264 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3)
0:24.017 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath
0:24.771 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath
0:25.525 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath
0:26.279 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath
0:27.033 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath
0:27.787 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), blade_of_wrath
0:28.543 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3)
0:29.298 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3)
0:30.052 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3), blade_of_wrath
0:31.015 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), blade_of_wrath
0:31.978 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3), blade_of_wrath
0:32.940 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), blade_of_wrath
0:33.905 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:34.869 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3)
0:35.835 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3)
0:36.800 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:37.763 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), blade_of_wrath
0:38.727 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), blade_of_wrath
0:39.691 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), blade_of_wrath
0:40.850 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
0:42.102 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath, horrific_appendages
0:43.353 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), horrific_appendages
0:44.604 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
0:45.856 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
0:47.106 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), blade_of_wrath, horrific_appendages
0:48.357 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
0:49.608 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath, horrific_appendages
0:50.859 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath, horrific_appendages
0:52.111 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
0:53.362 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
0:54.612 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
0:55.864 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), blade_of_wrath
0:57.113 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath
0:58.364 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
0:59.614 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
1:00.865 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:02.117 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:03.368 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
1:04.618 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:05.869 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
1:07.121 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath
1:08.373 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath
1:09.624 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath
1:10.874 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
1:12.124 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
1:13.375 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath
1:14.626 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath
1:15.876 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath, horrific_appendages
1:17.126 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
1:18.376 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
1:19.626 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), blade_of_wrath, horrific_appendages
1:20.878 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
1:22.128 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
1:23.378 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
1:24.630 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), horrific_appendages
1:25.880 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), horrific_appendages
1:27.131 Waiting     1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
1:28.131 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
1:29.604 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), horrific_appendages
1:30.000 default 9 shield_of_vengeance Illaz 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, horrific_appendages
1:30.854 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, horrific_appendages
1:32.104 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, horrific_appendages
1:33.357 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, horrific_appendages
1:34.605 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
1:35.854 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance
1:37.104 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance
1:38.356 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
1:39.606 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance
1:40.858 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance
1:42.108 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
1:43.360 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
1:44.611 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
1:45.862 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath
1:47.114 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:48.365 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:49.614 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), blade_of_wrath
1:50.864 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath
1:52.114 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:53.366 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:54.617 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
1:55.867 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:57.117 Waiting     1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:58.117 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:59.592 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:00.842 Waiting     0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:01.742 default A crusade Illaz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:01.928 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3)
2:03.296 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3)
2:04.505 default 6 potion Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), blade_of_wrath
2:04.505 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), blade_of_wrath, potion_of_the_old_war
2:05.601 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), blade_of_wrath, potion_of_the_old_war
2:06.699 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), blade_of_wrath, potion_of_the_old_war
2:07.703 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(7), zeal(3), potion_of_the_old_war
2:08.709 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), zeal(3), potion_of_the_old_war
2:09.635 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), blade_of_wrath, potion_of_the_old_war
2:10.562 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), blade_of_wrath, horrific_appendages, potion_of_the_old_war
2:11.424 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), blade_of_wrath, horrific_appendages, potion_of_the_old_war
2:12.285 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), zeal(3), blade_of_wrath, horrific_appendages, potion_of_the_old_war
2:13.146 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), zeal(3), blade_of_wrath, horrific_appendages, potion_of_the_old_war
2:14.007 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), zeal(3), blade_of_wrath, horrific_appendages, potion_of_the_old_war
2:14.869 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:15.690 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:16.512 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:17.334 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:18.243 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:19.064 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:19.885 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:20.821 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), horrific_appendages, potion_of_the_old_war
2:21.644 Waiting     0.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:22.044 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:23.046 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:23.965 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:24.787 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:25.610 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:26.431 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:27.362 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:28.185 Waiting     0.500 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:28.685 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), potion_of_the_old_war
2:29.690 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath
2:30.941 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath
2:32.192 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:33.443 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:34.693 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath
2:35.944 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), blade_of_wrath
2:37.196 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:38.446 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:39.694 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
2:40.943 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:42.192 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:43.444 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath
2:44.695 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath
2:45.945 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:47.195 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:48.445 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:49.695 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
2:50.946 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
2:52.197 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
2:53.449 Waiting     1.000 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath, horrific_appendages
2:54.449 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath, horrific_appendages
2:55.919 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), horrific_appendages
2:57.169 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), horrific_appendages
2:58.419 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
2:59.668 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:00.000 default 9 shield_of_vengeance Illaz 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), blade_of_wrath, shield_of_vengeance, horrific_appendages
3:00.919 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:02.167 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:03.415 Waiting     1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:04.415 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:05.893 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:07.142 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:08.397 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:09.646 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:10.897 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:12.147 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:13.399 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:14.650 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, horrific_appendages
3:15.902 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:17.153 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:18.403 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:19.652 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
3:20.901 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), horrific_appendages
3:22.151 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), horrific_appendages
3:23.401 Waiting     1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
3:24.401 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
3:25.879 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), horrific_appendages
3:27.129 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
3:28.378 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:29.628 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:30.877 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:32.126 Waiting     1.000 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:33.126 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:34.607 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
3:35.859 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
3:37.110 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:38.362 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:39.612 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, horrific_appendages
3:40.863 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), horrific_appendages
3:42.113 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), horrific_appendages
3:43.364 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), horrific_appendages
3:44.615 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages
3:45.866 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath
3:47.118 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath
3:48.370 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath
3:49.618 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:50.868 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:52.118 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:53.368 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:54.622 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:55.873 Waiting     1.000 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath
3:56.873 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath
3:58.343 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
3:59.594 Waiting     2.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
4:01.694 default A crusade Illaz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
4:01.928 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3)
4:03.136 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3)
4:04.232 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), blade_of_wrath
4:05.329 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), blade_of_wrath
4:06.333 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), blade_of_wrath
4:07.338 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3)
4:08.343 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3)
4:09.347 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3)
4:10.275 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), zeal(3)
4:11.202 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3)
4:12.129 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3)
4:12.987 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), zeal(3)
4:13.847 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3)
4:14.669 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3)
4:15.492 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3)
4:16.313 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3)
4:17.134 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), blade_of_wrath
4:17.957 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3), blade_of_wrath
4:18.778 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), blade_of_wrath
4:19.598 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), blade_of_wrath
4:20.420 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3)
4:21.241 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), blade_of_wrath
4:22.062 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), blade_of_wrath
4:22.884 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), blade_of_wrath
4:23.705 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), blade_of_wrath
4:24.528 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3)
4:25.350 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3)
4:26.173 Waiting     0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3)
4:26.773 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3)
4:27.785 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3), blade_of_wrath
4:28.607 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), blade_of_wrath
4:29.428 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath
4:30.000 default 9 shield_of_vengeance Illaz 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:30.678 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:31.928 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:33.178 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance
4:34.428 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:35.680 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:36.930 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
4:38.181 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
4:39.432 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
4:40.683 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:41.934 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance
4:43.380 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
4:44.632 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath, shield_of_vengeance
4:45.884 default G zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
4:47.133 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
4:48.385 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
4:49.635 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:50.884 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:52.134 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
4:53.385 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:54.635 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:55.886 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
4:57.135 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:58.385 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), blade_of_wrath
4:59.634 default H judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), blade_of_wrath
5:00.884 default I templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), horrific_appendages
5:02.135 default J zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), horrific_appendages
5:03.386 Waiting     0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), horrific_appendages

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 30131 28425 16840 (13280)
Agility 3200 3200 0
Stamina 43810 43810 27057
Intellect 7328 7328 0
Spirit 0 0 0
Health 2628600 2628600 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 30131 28425 0
Crit 20.84% 20.84% 6337
Haste 20.31% 19.29% 7233
Damage / Heal Versatility 1.69% 1.69% 805
Attack Power 30131 28425 0
Mastery 38.54% 38.54% 7076
Armor 4378 4378 4378
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 877.00
Local Head Venom-Fanged Barbute
ilevel: 885, stats: { 599 Armor, +2829 Sta, +1886 StrInt, +881 Haste, +680 Mastery }
Local Neck Soultrapper's Pendant
ilevel: 865, stats: { +1321 Sta, +1423 Crit, +948 Mastery }
Local Shoulders Ashes to Dust
ilevel: 910, stats: { 585 Armor, +2680 Sta, +1786 StrInt, +735 Crit, +551 Haste }
Local Shirt Artisan Officer's Shirt
ilevel: 1
Local Chest Breastplate of the Highlord
ilevel: 875, stats: { 721 Armor, +2578 Sta, +1719 StrInt, +914 Mastery, +591 Crit }
Local Waist Arcane Defender's Belt
ilevel: 860, stats: { 393 Armor, +1121 StrInt, +1681 Sta, +625 Mastery, +442 Haste }
Local Legs Tyelca, Ferren Marcus's Stature
ilevel: 910, stats: { 682 Armor, +3573 Sta, +2382 StrInt, +735 Crit, +980 Mastery }
Local Feet Lead-Soled Seabed Striders
ilevel: 875, stats: { 496 Armor, +1933 Sta, +1289 StrInt, +782 Haste, +346 Crit }
Local Wrists Dragonbone Wristclamps
ilevel: 875, stats: { 316 Armor, +1450 Sta, +967 StrInt, +568 Mastery, +278 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 875, stats: { 451 Armor, +1933 Sta, +1289 StrInt, +733 Haste, +394 Mastery }
Local Finger1 Mana-Dowsing Ring
ilevel: 860, stats: { +1261 Sta, +1513 Haste, +789 Vers }, gems: { +150 Crit }
Local Finger2 Ring of Ascended Glory
ilevel: 875, stats: { +1450 Sta, +1368 Haste, +1151 Crit }
Local Trinket1 Spontaneous Appendages
ilevel: 865, stats: { +1036 Mastery }
Local Trinket2 Ursoc's Rending Paw
ilevel: 865, stats: { +1489 Str }
Local Back Cloak of Enthralling Darkness
ilevel: 860, stats: { 135 Armor, +841 StrAgiInt, +1261 Sta, +543 Haste, +257 Crit }
Local Main Hand Ashbringer
ilevel: 895, weapon: { 10206 - 15311, 3.6 }, stats: { +2071 Str, +3107 Sta, +825 Crit, +792 Mastery }, relics: { +48 ilevels, +49 ilevels, +48 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice (Retribution Paladin) Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Judgment of Light
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Illaz"
origin="https://eu.api.battle.net/wow/character/hyjal/Illaz/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/50/146654770-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=350/herbalism=796
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!0121001
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:44:3:47:3:49:1:50:3:51:3:52:3:53:3:54:1:350:1:351:1:352:1:353:1:1118:2:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5&(buff.crusade.up|buff.avenging_wrath.up|time<2)
actions+=/judgment,if=time<2
actions+=/blade_of_justice,if=time<2&(equipped.137048|race.blood_elf)
actions+=/divine_hammer,if=time<2&(equipped.137048|race.blood_elf)
actions+=/wake_of_ashes,if=holy_power<=1&time<2
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5&!equipped.137048|((equipped.137048|race.blood_elf)&time<2|time>2&holy_power>=4)
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
actions+=/blade_of_justice,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
actions+=/divine_hammer,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
actions+=/blade_of_justice,if=talent.blade_of_wrath.enabled&holy_power<=3
actions+=/zeal,if=charges=2&holy_power<=4
actions+=/crusader_strike,if=charges=2&holy_power<=4
actions+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions+=/divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
actions+=/consecration
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/templars_verdict,if=debuff.judgment.up&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/zeal,if=holy_power<=4
actions+=/crusader_strike,if=holy_power<=4
actions+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=venomfanged_barbute,id=139229,bonus_id=1805/1507/3337
neck=soultrappers_pendant,id=141506,bonus_id=3466/1477/3336
shoulders=ashes_to_dust,id=144358,bonus_id=3459/3458
back=cloak_of_enthralling_darkness,id=137531,bonus_id=3412/1512/3336
chest=breastplate_of_the_highlord,id=138350,bonus_id=3514/1472/1813
shirt=artisan_officers_shirt,id=89195
wrists=dragonbone_wristclamps,id=138218,bonus_id=1805/1497/3336
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1497/3336
waist=arcane_defenders_belt,id=134269,bonus_id=3473/1522/3337
legs=tyelca_ferren_marcuss_stature,id=137070,bonus_id=1811/3458
feet=leadsoled_seabed_striders,id=142426,bonus_id=3468/1492
finger1=manadowsing_ring,id=141488,bonus_id=1808/3466/1472,gems=150crit
finger2=ring_of_ascended_glory,id=142520,bonus_id=3468/1492
trinket1=spontaneous_appendages,id=139325,bonus_id=1805/1487
trinket2=ursocs_rending_paw,id=139328,bonus_id=1805/1487
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=139258/137375/139252/0,relic_id=1807:1487:3337/3416:1522:3336/1805:1487/0

# Gear Summary
# gear_ilvl=876.67
# gear_strength=16840
# gear_stamina=27057
# gear_crit_rating=6213
# gear_haste_rating=7091
# gear_mastery_rating=6937
# gear_versatility_rating=789
# gear_armor=4378

Jukkayoto

Jukkayoto : 517701 dps

  • Race: Human
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
517700.6 517700.6 359.6 / 0.069% 69874.5 / 13.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.93% 61.7 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Jukkayoto/advanced
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: The Fires of Justice (Retribution Paladin)
  • 45: Blinding Light
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Eye for an Eye (Retribution Paladin)
  • 90: Divine Intervention (Retribution Paladin)
  • 100: Crusade (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 800
  • blacksmithing: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Jukkayoto 517701
Blade of Justice 61169 11.8% 56.6 5.32sec 324309 332299 Direct 56.6 272014 543236 324313 19.3%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.64 56.64 0.00 0.00 0.9760 0.0000 18368512.61 27003453.45 31.98 332299.38 332299.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.72 80.72% 272014.13 220387 369699 272158.52 250161 297481 12435690 18281642 31.98
crit 10.92 19.28% 543236.19 440774 739398 543601.86 440774 739398 5932823 8721812 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<2&(equipped.137048|race.blood_elf)
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Crusader Strike 63670 12.3% 106.1 2.79sec 180295 182554 Direct 106.1 131546 262944 180293 37.1%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.13 106.13 0.00 0.00 0.9876 0.0000 19135302.88 28130707.77 31.98 182553.93 182553.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.76 62.90% 131546.43 107782 180805 131610.10 119432 143859 8781558 12909722 31.98
crit 39.38 37.10% 262944.02 215565 361610 263039.56 228718 298388 10353745 15220986 31.98
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for ${$sw2*$<mult>} Physical damage.$?a231667[ Maximum 2 charges.][]{$?s85256=true}[ |cFFFFFFFFGenerates {$s3=1} Holy Power.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Templar's Verdict (echoed_verdict) 23011 4.5% 92.7 3.23sec 74581 0 Direct 92.7 62511 125138 74582 19.3%  

Stats details: echoed_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.71 92.71 0.00 0.00 0.0000 0.0000 6914220.52 6914220.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.84 80.73% 62511.12 37372 88024 62543.48 57986 67330 4678232 4678232 0.00
crit 17.87 19.27% 125137.93 74744 176049 125197.07 93621 161851 2235988 2235988 0.00
 
 

Action details: echoed_verdict

Static Values
  • id:224266
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:224266
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $sw1 Holy damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.40
 
Judgment 38435 7.4% 34.8 8.81sec 332239 334512 Direct 34.7 278833 557949 332401 19.2%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.76 34.75 0.00 0.00 0.9932 0.0000 11550032.88 11550032.88 0.00 334512.07 334512.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.08 80.81% 278832.89 232457 389947 278907.88 239089 311052 7829218 7829218 0.00
crit 6.67 19.19% 557948.83 464915 779895 557722.30 0 779895 3720815 3720815 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 24287 4.7% 132.1 2.27sec 55201 24340 Direct 132.1 46290 92548 55203 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.10 132.10 0.00 0.00 2.2679 0.0000 7292089.58 10720062.40 31.98 24339.91 24339.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.65 80.73% 46289.76 37489 62887 46316.30 43516 49145 4936751 7257492 31.98
crit 25.45 19.27% 92547.96 74978 125775 92596.25 77885 110766 2355338 3462570 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 34546 6.6% 39.5 3.99sec 258917 0 Direct 39.5 217133 433844 258922 19.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.46 39.46 0.00 0.00 0.0000 0.0000 10216805.94 15019672.49 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.85 80.72% 217133.44 135911 227991 217116.66 205666 226317 6915999 10167173 31.98
crit 7.61 19.28% 433843.76 271822 455982 433470.30 0 455982 3300807 4852499 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rend Flesh 5496 1.1% 19.3 15.33sec 85445 0 Periodic 70.5 19622 39180 23421 19.4% 46.9%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.33 0.00 70.53 70.53 0.0000 2.0000 1651878.78 1651878.78 0.00 11710.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.8 80.58% 19622.36 15023 78322 19621.02 15797 26952 1115172 1115172 0.00
crit 13.7 19.42% 39180.18 30047 156644 39176.71 30047 67631 536707 536707 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_of_vengeance_proc 13046 2.5% 3.8 89.42sec 1027906 0 Direct 3.6 905644 1815328 1079991 19.2%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 3.62 0.00 0.00 0.0000 0.0000 3906434.30 3906434.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.92 80.82% 905644.38 763083 1280072 903740.43 0 1280072 2647272 2647272 0.00
crit 0.69 19.18% 1815327.64 1526166 2560143 959560.38 0 2560143 1259163 1259163 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:648880.00
  • base_dd_max:648880.00
 
Templar's Verdict 228937 44.3% 93.0 3.23sec 739815 748482 Direct 93.0 620511 1240779 739812 19.2%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.97 92.97 0.00 0.00 0.9884 0.0000 68779541.19 68779541.19 0.00 748482.36 748482.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.09 80.76% 620511.39 456292 880245 620782.96 566093 666261 46591272 46591272 0.00
crit 17.88 19.24% 1240778.83 912585 1760490 1241370.46 981029 1605955 22188269 22188269 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 25103 4.9% 9.9 31.76sec 758915 753933 Direct 9.9 314485 626466 374233 19.2%  
Periodic 59.0 54335 108708 64832 19.3% 19.6%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.94 9.94 58.99 58.99 1.0067 1.0000 7545360.33 7545360.33 0.00 109353.05 753932.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.04 80.84% 314484.90 277763 465948 314487.98 277763 397514 2527757 2527757 0.00
crit 1.90 19.16% 626466.44 555527 931896 547850.38 0 931896 1193113 1193113 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.6 80.70% 54334.96 47006 78852 54336.93 49332 58890 2586566 2586566 0.00
crit 11.4 19.30% 108707.66 94012 157705 108690.03 94012 142071 1237924 1237924 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=1&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec.][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Jukkayoto
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Jukkayoto
  • harmful:false
  • if_expr:
 
Crusade 3.0 120.28sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Jukkayoto
  • harmful:false
  • if_expr:holy_power>=5&!equipped.137048|((equipped.137048|race.blood_elf)&time<2|time>2&holy_power>=4)
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s2=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Jukkayoto
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Jukkayoto
  • harmful:false
  • if_expr:
 
Judgment (_aoe) 34.7 8.77sec

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<2
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rend Flesh (rending_flesh_trigger) 19.3 15.33sec

Stats details: rending_flesh_trigger

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rending_flesh_trigger

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51100.00
  • base_dd_max:51100.00
 
Shield of Vengeance 3.8 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.80 3.80 0.00 0.00 0.0000 0.0000 0.00 2465990.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.07 80.75% 0.00 0 0 0.00 0 0 0 1991352 99.68
crit 0.73 19.25% 0.00 0 0 0.00 0 0 0 474638 54.93
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Jukkayoto
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*{$s2=20}} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade of Wrath! 26.4 9.3 11.4sec 8.4sec 33.29% 33.29% 9.3(9.3) 26.1

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_blade_of_wrath
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blade_of_wrath_1:33.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231843
  • name:Blade of Wrath!
  • tooltip:
  • description:{$@spelldesc231832=Your auto attacks have a chance to reset the cooldown of Blade of Justice.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 21.04% 0.0(0.0) 1.0

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crusade 3.0 35.3 120.3sec 7.1sec 28.39% 100.00% 23.5(64.8) 2.7

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.12%
  • crusade_4:2.00%
  • crusade_7:2.50%
  • crusade_10:2.66%
  • crusade_13:2.26%
  • crusade_15:18.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s2=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Down Draft 3.5 0.0 69.5sec 69.5sec 22.29% 22.29% 3.2(3.2) 3.2

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_down_draft
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:411.47

Stack Uptimes

  • down_draft_1:1.15%
  • down_draft_2:1.15%
  • down_draft_3:1.15%
  • down_draft_4:1.14%
  • down_draft_5:1.14%
  • down_draft_6:1.13%
  • down_draft_7:1.13%
  • down_draft_8:1.12%
  • down_draft_9:1.12%
  • down_draft_10:1.12%
  • down_draft_11:1.11%
  • down_draft_12:1.11%
  • down_draft_13:1.11%
  • down_draft_14:1.10%
  • down_draft_15:1.10%
  • down_draft_16:1.09%
  • down_draft_17:1.09%
  • down_draft_18:1.08%
  • down_draft_19:1.08%
  • down_draft_20:1.08%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:214342
  • name:Down Draft
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214340=Your melee attacks have a chance to grant you {$214342s1=319} Haste every $215024t2 sec for {$215024d=20 seconds}.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 13.0 4.2 23.1sec 17.1sec 29.87% 29.87% 4.2(4.2) 12.7

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 127.6sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shield of Vengeance 3.8 0.0 90.0sec 90.0sec 18.47% 18.47% 0.0(0.0) 3.6

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*{$s2=20}} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
The Fires of Justice 15.5 0.4 18.4sec 17.9sec 9.28% 9.67% 0.4(0.4) 0.0

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_the_fires_of_justice
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • the_fires_of_justice_1:9.28%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:209785
  • name:The Fires of Justice
  • tooltip:Your next damaging or healing Holy Power spender costs {$s2=1} less Holy Power.
  • description:{$@spelldesc203316=Reduces the cooldown of Crusader Strike by ${$m2/-1000}.1 sec and gives it a {$h=15}% chance to reduce the cost of your next damaging or healing Holy Power ability by {$209785s1=1}.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Whisper of the Nathrezim 92.9 0.0 3.2sec 3.2sec 84.09% 80.89% 0.0(0.0) 16.9

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_whisper_of_the_nathrezim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • whisper_of_the_nathrezim_1:84.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207635
  • name:Whisper of the Nathrezim
  • tooltip:Increases damage done by your next Templar's Verdict or Divine Storm by {$s1=15}%.
  • description:{$@spelldesc207633=Templar's Verdict and Divine Storm increase the damage of your next Templar's Verdict or Divine Storm within {$207635d=4 seconds} by {$207635s1=15}%.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
the_fires_of_justice 15.9 17.9sec
blade_of_wrath 35.7 8.4sec

Resources

Resource Usage Type Count Total Average RPE APR
Jukkayoto
templars_verdict Holy Power 93.0 263.5 2.8 2.8 261020.0
Resource Gains Type Count Total Average Overflow
blade_of_justice Holy Power 56.64 113.28 (42.60%) 2.00 0.00 0.00%
wake_of_ashes Holy Power 9.94 46.52 (17.49%) 4.68 3.19 6.42%
crusader_strike Holy Power 106.13 106.13 (39.91%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.88 0.88
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.41 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Jukkayoto Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Jukkayoto Damage Per Second
Count 9999
Mean 517700.58
Minimum 459693.36
Maximum 587188.55
Spread ( max - min ) 127495.20
Range [ ( max - min ) / 2 * 100% ] 12.31%
Standard Deviation 18346.6510
5th Percentile 488106.81
95th Percentile 547453.60
( 95th Percentile - 5th Percentile ) 59346.79
Mean Distribution
Standard Deviation 183.4757
95.00% Confidence Intervall ( 517340.98 - 518060.19 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4825
0.1 Scale Factor Error with Delta=300 2873408
0.05 Scale Factor Error with Delta=300 11493632
0.01 Scale Factor Error with Delta=300 287340783
Priority Target DPS
Sample Data Jukkayoto Priority Target Damage Per Second
Count 9999
Mean 517700.58
Minimum 459693.36
Maximum 587188.55
Spread ( max - min ) 127495.20
Range [ ( max - min ) / 2 * 100% ] 12.31%
Standard Deviation 18346.6510
5th Percentile 488106.81
95th Percentile 547453.60
( 95th Percentile - 5th Percentile ) 59346.79
Mean Distribution
Standard Deviation 183.4757
95.00% Confidence Intervall ( 517340.98 - 518060.19 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4825
0.1 Scale Factor Error with Delta=300 2873408
0.05 Scale Factor Error with Delta=300 11493632
0.01 Scale Factor Error with Delta=300 287340783
DPS(e)
Sample Data Jukkayoto Damage Per Second (Effective)
Count 9999
Mean 517700.58
Minimum 459693.36
Maximum 587188.55
Spread ( max - min ) 127495.20
Range [ ( max - min ) / 2 * 100% ] 12.31%
Damage
Sample Data Jukkayoto Damage
Count 9999
Mean 155360179.00
Minimum 112974471.66
Maximum 192545797.72
Spread ( max - min ) 79571326.06
Range [ ( max - min ) / 2 * 100% ] 25.61%
DTPS
Sample Data Jukkayoto Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Jukkayoto Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Jukkayoto Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Jukkayoto Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Jukkayoto Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Jukkayoto Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data JukkayotoTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Jukkayoto Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 rebuke
6 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5&(buff.crusade.up|buff.avenging_wrath.up|time<2)
7 1.00 judgment,if=time<2
0.00 blade_of_justice,if=time<2&(equipped.137048|race.blood_elf)
0.00 divine_hammer,if=time<2&(equipped.137048|race.blood_elf)
8 1.00 wake_of_ashes,if=holy_power<=1&time<2
0.00 holy_wrath
0.00 avenging_wrath
9 3.80 shield_of_vengeance
A 3.00 crusade,if=holy_power>=5&!equipped.137048|((equipped.137048|race.blood_elf)&time<2|time>2&holy_power>=4)
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
B 21.74 templars_verdict,if=debuff.judgment.up&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
C 23.95 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
D 20.83 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
E 8.94 wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
F 19.94 blade_of_justice,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
0.00 divine_hammer,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
G 36.70 blade_of_justice,if=talent.blade_of_wrath.enabled&holy_power<=3
0.00 zeal,if=charges=2&holy_power<=4
H 50.77 crusader_strike,if=charges=2&holy_power<=4
0.00 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
0.00 divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
I 33.77 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
J 6.50 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
K 19.06 templars_verdict,if=debuff.judgment.up&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 zeal,if=holy_power<=4
L 55.37 crusader_strike,if=holy_power<=4
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
M 0.89 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

01245798ABGBHJLLGBGHIBHBGHBHIFBGHBHIFBHLFBHIHBGHBECGHCIHJLGKHLDILGKHFDHILGKHLDLLEICFHCLJLLGICLJLFDHIJHL9GKLLIDECFHCGHICFHCLKLLGILABGBHI6LBEBGBHLIJLGKHLFCIHKLLFKLILKLGKLLIGJFDHGDEICHLDFGCHIDHLGK9LLGICLKLLGDILDECFHCGHICHKLFDHILLMFLDGIHDLECGHICHJLFCGHIABBHLFBLILBLGBGHDGGHICHDECGHCIHKLGKH9LILDFHDIHLLGCGLICHDECGHICHKLFDH

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Jukkayoto 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre precombat 1 food Jukkayoto 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre precombat 2 augmentation Jukkayoto 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 default 5 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 default 7 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, potion_of_the_old_war
0:00.000 default 9 shield_of_vengeance Jukkayoto 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:00.866 default 8 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:01.732 default A crusade Jukkayoto 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:01.732 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:02.569 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:03.330 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:04.091 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:04.846 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:05.600 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(10), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:06.356 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:07.110 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:07.863 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:08.616 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:09.370 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:10.125 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:10.879 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:11.632 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:12.387 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:13.141 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:13.894 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:14.648 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:15.404 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
0:16.158 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
0:16.914 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:17.669 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:18.422 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:19.169 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, down_draft, potion_of_the_old_war
0:19.905 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(2), potion_of_the_old_war
0:20.657 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(3), potion_of_the_old_war
0:21.411 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, down_draft(3), potion_of_the_old_war
0:22.159 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(4), potion_of_the_old_war
0:22.911 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(5), potion_of_the_old_war
0:23.664 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(6)
0:24.417 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(6)
0:25.164 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(7)
0:25.927 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, down_draft(8)
0:26.679 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, down_draft(9)
0:27.433 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, down_draft(10)
0:28.187 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, down_draft(10)
0:28.938 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, down_draft(11)
0:29.691 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, down_draft(12)
0:30.444 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, down_draft(13)
0:31.195 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(13)
0:31.945 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(14)
0:32.717 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(15)
0:33.486 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(16)
0:34.250 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(16)
0:35.009 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(17)
0:35.764 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(18)
0:36.518 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw, down_draft(19)
0:37.275 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, the_fires_of_justice, whisper_of_the_nathrezim, down_draft(19)
0:38.032 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, whisper_of_the_nathrezim, down_draft(20)
0:38.849 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim
0:39.734 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, whisper_of_the_nathrezim
0:40.802 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:41.950 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:43.098 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
0:44.247 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
0:45.394 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
0:46.542 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
0:47.690 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath
0:48.829 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:49.953 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:51.077 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:52.202 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw
0:53.327 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
0:54.451 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
0:55.597 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath
0:56.745 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath
0:57.893 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:59.041 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:00.189 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:01.334 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
1:02.481 Waiting     0.500 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:02.981 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:04.345 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:05.469 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power mark_of_the_claw
1:06.596 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
1:07.718 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:08.843 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:09.991 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:11.139 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:12.286 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
1:13.432 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:14.580 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:15.728 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:16.877 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:18.023 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:19.169 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:20.317 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
1:21.463 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:22.611 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:23.759 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:24.907 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:26.054 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim
1:27.178 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw
1:28.302 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:29.425 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:30.000 default 9 shield_of_vengeance Jukkayoto 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:30.550 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:31.674 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power shield_of_vengeance, mark_of_the_claw
1:32.814 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:33.960 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:35.107 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:36.254 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power shield_of_vengeance
1:37.401 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:38.547 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:39.693 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:40.841 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:41.988 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:43.135 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:44.261 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:45.385 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:46.510 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
1:47.633 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:48.759 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:49.899 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:51.048 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:52.197 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:53.335 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:54.460 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:55.585 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:56.709 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power mark_of_the_claw
1:57.833 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power mark_of_the_claw
1:58.957 Waiting     2.600 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power mark_of_the_claw
2:01.557 default A crusade Jukkayoto 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath
2:01.732 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, blade_of_wrath
2:02.842 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim
2:03.850 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), whisper_of_the_nathrezim
2:04.855 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), whisper_of_the_nathrezim
2:05.777 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim
2:06.735 default 6 potion Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim
2:06.735 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim, potion_of_the_old_war
2:07.658 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:08.581 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:09.433 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:10.285 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:11.076 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), whisper_of_the_nathrezim, potion_of_the_old_war
2:11.867 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:12.623 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:13.377 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:14.130 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:14.884 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:15.639 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:16.542 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:17.296 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:18.050 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:18.805 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:19.560 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:20.315 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:21.068 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:21.822 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:22.561 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:23.315 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:24.069 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:24.825 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:25.579 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:26.333 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:27.088 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:27.843 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:28.599 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:29.353 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:30.106 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:30.860 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:31.615 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:32.371 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim
2:33.518 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
2:34.666 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath
2:35.814 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:36.963 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:38.109 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:39.256 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:40.405 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:41.553 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:42.700 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
2:43.847 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
2:44.995 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:46.143 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:47.292 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
2:48.439 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:49.586 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:50.735 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:51.883 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:53.030 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:54.179 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:55.327 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
2:56.473 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:57.620 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:58.744 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power mark_of_the_claw
2:59.869 default 9 shield_of_vengeance Jukkayoto 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:00.000 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:01.124 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:02.249 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:03.371 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, shield_of_vengeance, mark_of_the_claw
3:04.494 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance, mark_of_the_claw
3:05.618 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:06.741 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:07.881 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:09.028 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:10.176 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance
3:11.324 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, shield_of_vengeance
3:12.474 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:13.622 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:14.769 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:15.916 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:17.063 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:18.211 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:19.356 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
3:20.501 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:21.648 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:22.795 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:23.941 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:25.088 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:26.235 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:27.382 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:28.529 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:29.677 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:30.823 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:31.970 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:33.119 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:34.268 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:35.404 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power down_draft(2)
3:36.530 default M templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power down_draft(3)
3:37.646 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, down_draft(4)
3:38.751 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, down_draft(5)
3:39.847 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, down_draft(6)
3:40.934 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim, down_draft(7)
3:42.010 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, down_draft(8)
3:43.079 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, down_draft(9)
3:44.139 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, down_draft(10)
3:45.171 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw, down_draft(11)
3:46.196 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw, down_draft(12)
3:47.210 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw, down_draft(13)
3:48.218 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw, down_draft(14)
3:49.217 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw, down_draft(15)
3:50.210 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, whisper_of_the_nathrezim, down_draft(16)
3:51.210 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, whisper_of_the_nathrezim, down_draft(17)
3:52.206 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, down_draft(18)
3:53.194 default J templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim, down_draft(19)
3:54.176 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, down_draft(20)
3:55.309 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:56.457 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:57.605 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:58.753 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:59.902 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
4:01.049 Waiting     0.500 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
4:01.549 default A crusade Jukkayoto 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
4:01.732 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, the_fires_of_justice
4:02.841 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), whisper_of_the_nathrezim
4:03.849 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(7), whisper_of_the_nathrezim
4:04.752 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), whisper_of_the_nathrezim, mark_of_the_claw
4:05.658 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim, mark_of_the_claw
4:06.562 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), whisper_of_the_nathrezim, mark_of_the_claw
4:07.465 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), whisper_of_the_nathrezim, mark_of_the_claw
4:08.301 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), whisper_of_the_nathrezim, mark_of_the_claw
4:09.136 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), whisper_of_the_nathrezim, mark_of_the_claw
4:09.973 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), whisper_of_the_nathrezim
4:10.825 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), whisper_of_the_nathrezim
4:11.617 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), whisper_of_the_nathrezim
4:12.624 default B templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), whisper_of_the_nathrezim
4:13.399 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:14.154 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:14.910 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:15.665 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:16.419 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:17.174 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:17.929 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:18.685 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:19.441 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:20.196 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:20.951 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:21.706 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:22.462 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:23.216 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim
4:23.971 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:24.725 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:25.480 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:26.235 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:26.991 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim
4:27.746 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim
4:28.500 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:29.254 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim
4:30.000 default 9 shield_of_vengeance Jukkayoto 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance
4:30.009 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance
4:30.763 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance
4:31.517 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance
4:32.271 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:33.420 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:34.568 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:35.716 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:36.864 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:38.011 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:39.159 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:40.307 Waiting     0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power shield_of_vengeance
4:40.507 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power shield_of_vengeance
4:41.828 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power shield_of_vengeance
4:42.975 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance
4:44.122 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
4:45.270 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:46.418 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
4:47.563 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
4:48.711 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
4:49.860 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
4:51.007 default E wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
4:52.155 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
4:53.302 default G blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
4:54.426 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw
4:55.549 default I judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw
4:56.673 default C templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power mark_of_the_claw
4:57.798 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
4:58.922 default K templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
5:00.063 default L crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
5:01.210 default F blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
5:02.359 default D templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
5:03.499 default H crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 32444 30738 19043 (14941)
Agility 3200 3200 0
Stamina 47485 47485 27359
Intellect 7328 7328 0
Spirit 0 0 0
Health 2849100 2849100 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 32444 30738 0
Crit 18.50% 18.50% 5401
Haste 31.14% 30.13% 11297
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 32444 30738 0
Mastery 27.64% 27.64% 4170
Armor 4350 4350 4350
Run Speed 7 0 445
Leech 2.86% 2.86% 657

Gear

Source Slot Average Item Level: 882.00
Local Head Helmet of Reverent Loyalty
ilevel: 870, stats: { 580 Armor, +1641 StrInt, +2461 Sta, +865 Haste, +612 Mastery }
Local Neck Radiant String of Scorpid Eyes
ilevel: 875, stats: { +1450 Sta, +1728 Haste, +792 Crit }, enchant: mark_of_the_claw
Local Shoulders Nightsfall Shoulderplates
ilevel: 875, stats: { 541 Armor, +1289 StrInt, +1934 Sta, +661 Haste, +467 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Inferno Breastplate
ilevel: 875, stats: { 721 Armor, +1719 StrInt, +2578 Sta, +914 Haste, +591 Crit }, gems: { +150 Haste }
Local Waist Chain of Thrayn
ilevel: 910, stats: { 438 Armor, +2680 Sta, +1786 StrInt, +459 Crit, +827 Haste }
Local Legs Storm-Battered Legplates
ilevel: 880, stats: { 638 Armor, +2701 Sta, +1801 StrInt, +898 Haste, +635 Mastery, +657 Leech }
Local Feet Lead-Soled Seabed Striders
ilevel: 875, stats: { 496 Armor, +1933 Sta, +1289 StrInt, +782 Haste, +346 Crit }
Local Wrists Void-Touched Wristplates
ilevel: 880, stats: { 319 Armor, +1519 Sta, +1013 StrInt, +616 Haste, +246 Mastery }
Local Hands The Soulbinder's Gauntlets
ilevel: 880, stats: { 456 Armor, +1351 StrInt, +2027 Sta, +576 Haste, +576 Mastery }
Local Finger1 Marshstomper Oracle's Loop
ilevel: 880, stats: { +1519 Sta, +445 RunSpeed, +1856 Haste, +742 Mastery }, enchant: { +200 Haste }
Local Finger2 Demonic Birthstone Ring
ilevel: 860, stats: { +1261 Sta, +1644 Crit, +658 Haste }
Local Trinket1 Ursoc's Rending Paw
ilevel: 880, stats: { +1712 Str }
Local Trinket2 Nightmare Egg Shell
ilevel: 880, stats: { +1712 StrAgi }
Local Back Whisper of the Nathrezim
ilevel: 910, stats: { 161 Armor, +2010 Sta, +1340 StrInt, +620 Crit, +344 Haste }, enchant: { +200 Str }
Local Main Hand Ashbringer
ilevel: 901, weapon: { 10794 - 16192, 3.6 }, stats: { +2190 Str, +3286 Sta, +843 Crit, +810 Mastery }, relics: { +51 ilevels, +48 ilevels, +52 ilevels }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice (Retribution Paladin) Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Judgment of Light
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Jukkayoto"
origin="https://eu.api.battle.net/wow/character/hyjal/Jukkayoto/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/31/114773279-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=blacksmithing=800/mining=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!0021101
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:44:3:47:3:49:1:50:3:51:3:52:3:53:3:54:1:350:1:351:1:352:1:353:1:1118:15:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5&(buff.crusade.up|buff.avenging_wrath.up|time<2)
actions+=/judgment,if=time<2
actions+=/blade_of_justice,if=time<2&(equipped.137048|race.blood_elf)
actions+=/divine_hammer,if=time<2&(equipped.137048|race.blood_elf)
actions+=/wake_of_ashes,if=holy_power<=1&time<2
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5&!equipped.137048|((equipped.137048|race.blood_elf)&time<2|time>2&holy_power>=4)
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&buff.crusade.up&(buff.crusade.stack<15|buff.bloodlust.up)
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
actions+=/blade_of_justice,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
actions+=/divine_hammer,if=holy_power<=3&buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains>gcd&buff.whisper_of_the_nathrezim.remains<gcd*3&debuff.judgment.up&debuff.judgment.remains>gcd*2
actions+=/blade_of_justice,if=talent.blade_of_wrath.enabled&holy_power<=3
actions+=/zeal,if=charges=2&holy_power<=4
actions+=/crusader_strike,if=charges=2&holy_power<=4
actions+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions+=/divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
actions+=/consecration
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions+=/templars_verdict,if=debuff.judgment.up&(holy_power>=4|((cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd)))&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions+=/zeal,if=holy_power<=4
actions+=/crusader_strike,if=holy_power<=4
actions+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=helmet_of_reverent_loyalty,id=134513,bonus_id=3415/1522/3337
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3443/1472/3336,enchant=mark_of_the_claw
shoulders=nightsfall_shoulderplates,id=139060,bonus_id=3473/1537/3337
back=whisper_of_the_nathrezim,id=137020,bonus_id=3459/3458,enchant=200str
chest=inferno_breastplate,id=134503,bonus_id=3417/1808/1527/3337,gems=150haste
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
tabard=renowned_guild_tabard,id=69210
wrists=voidtouched_wristplates,id=133632,bonus_id=3417/1532/3337
hands=the_soulbinders_gauntlets,id=139996,bonus_id=3492
waist=chain_of_thrayn,id=137086,bonus_id=1811/3458
legs=stormbattered_legplates,id=139230,bonus_id=1806/41/1502
feet=leadsoled_seabed_striders,id=142426,bonus_id=3468/1492
finger1=marshstomper_oracles_loop,id=141544,bonus_id=42/3466/1492/3337,enchant=200haste
finger2=demonic_birthstone_ring,id=141486,bonus_id=1808/3466/1472
trinket1=ursocs_rending_paw,id=139328,bonus_id=1806/1502
trinket2=nightmare_egg_shell,id=137312,bonus_id=3416/1532/3337
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=139258/139266/139252/0,relic_id=1805:1497:3336/1805:1487/1806:1502/0

# Gear Summary
# gear_ilvl=882.07
# gear_strength=19043
# gear_stamina=27359
# gear_crit_rating=5295
# gear_haste_rating=11075
# gear_mastery_rating=4088
# gear_leech_rating=657
# gear_speed_rating=445
# gear_armor=4350

Waleràn

Waleràn : 426362 dps

  • Race: Dwarf
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
426361.8 426361.8 190.9 / 0.045% 38306.8 / 9.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 45.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Waleràn/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Lingering Insanity (Shadow Priest)
  • 75: San'layn (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • engineering: 704
  • inscription: 703

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Waleràn 426362
Deadly Grace 12674 2.9% 30.0 10.14sec 125171 0 Direct 30.0 90597 184978 125173 36.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.03 30.03 0.00 0.00 0.0000 0.0000 3759158.60 3759158.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.03 63.37% 90597.32 79878 105439 90585.71 83872 97299 1724185 1724185 0.00
crit 11.00 36.63% 184977.79 162951 215096 184976.38 162951 208578 2034974 2034974 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fel Meteor 9513 2.2% 37.5 7.97sec 76271 0 Direct 37.5 55220 112582 76270 36.7%  

Stats details: fel_meteor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.49 37.49 0.00 0.00 0.0000 0.0000 2859609.03 2859609.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.73 63.30% 55220.35 50202 66267 55225.40 51457 59791 1310609 1310609 0.00
crit 13.76 36.70% 112582.25 102412 135184 112595.70 102412 125558 1549000 1549000 0.00
 
 

Action details: fel_meteor

Static Values
  • id:214052
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214052
  • name:Fel Meteor
  • school:fire
  • tooltip:
  • description:{$@spelldesc214054=Your ranged attacks and spells have a chance to call down a Fel Meteor on your target, dealing {$214052s1=25742 to 28451} Fire damage to them and nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47271.36
  • base_dd_max:52247.29
 
Mark of the Hidden Satyr 9101 2.1% 23.5 12.54sec 116176 0 Direct 23.5 84253 171771 116172 36.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.55 23.55 0.00 0.00 0.0000 0.0000 2735478.04 2735478.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.96 63.53% 84252.69 76570 101072 84260.16 76570 93926 1260241 1260241 0.00
crit 8.59 36.47% 171771.14 156203 206187 171753.42 0 206187 1475237 1475237 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Blast 44874 10.5% 45.0 6.57sec 299678 321105 Direct 46.0 212277 433131 293177 36.6%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.03 46.03 0.00 0.00 0.9333 0.0000 13495404.63 13495404.63 0.00 321105.09 321105.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.17 63.37% 212277.00 182079 248289 212288.54 199624 225207 6192754 6192754 0.00
crit 16.86 36.63% 433130.67 371440 506509 433210.21 396766 482310 7302650 7302650 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 63518 14.9% 121.0 2.47sec 157916 124277 Periodic 326.5 42387 86466 58539 36.6% 49.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.02 0.00 326.45 326.45 1.2707 0.4525 19110267.82 19110267.82 0.00 124277.45 124277.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 206.8 63.36% 42387.38 36417 49660 42391.49 41268 43424 8767027 8767027 0.00
crit 119.6 36.64% 86466.37 74292 101307 86475.67 83699 89638 10343241 10343241 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=50}%.$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Sear (_tick) 0 0.0% 325.7 0.91sec

Stats details: mind_sear_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 325.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mind_sear_tick

Static Values
  • id:234702
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:234702
  • name:Mind Sear
  • school:shadow
  • tooltip:
  • description:When Mind Flay deals damage, if the target is afflicted by your Shadow Word: Pain, it deals {$237388s1=0} damage to all nearby targets. |cFFFFFFFFGenerates ${$208232m1/100} Insanity per target hit.|r
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 7955 1.9% 6.5 9.76sec 368777 370017 Direct 6.5 267427 545482 368788 36.4%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.46 6.46 0.00 0.00 0.9967 0.0000 2382167.21 2382167.21 0.00 370016.65 370016.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.11 63.55% 267426.79 236704 268982 266827.21 0 268982 1097812 1097812 0.00
crit 2.35 36.45% 545481.52 482876 548723 516328.63 0 548723 1284355 1284355 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&cooldown.shadow_word_death.charges=2&insanity<=(90-20*talent.reaper_of_souls.enabled)
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=15} Insanity, or $/100;190714s1 Insanity if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 58487 13.7% 6.1 46.44sec 2884152 3128130 Direct 6.1 38595 78722 53226 36.5%  
Periodic 245.3 50949 103927 70357 36.6% 99.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 6.10 245.26 245.26 0.9221 1.2192 17580090.23 17580090.23 0.00 57709.08 3128129.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.87 63.54% 38595.05 34301 81387 38452.06 0 63613 149471 149471 0.00
crit 2.22 36.46% 78721.93 69974 164121 73190.57 0 143129 174965 174965 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 155.4 63.37% 50949.46 37 83258 50967.52 48214 54038 7918211 7918211 0.00
crit 89.8 36.63% 103926.69 456 169846 103970.22 96465 112985 9337443 9337443 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.misery.enabled&dot.shadow_word_pain.remains<gcd.max
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=18 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.380000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.380000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 0 0.0% 244.3 1.20sec

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 244.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 8471 2.0% 125.7 2.37sec 20275 0 Direct 123.8 14895 30392 20573 36.6%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.65 123.83 0.00 0.00 0.0000 0.0000 2547575.96 2547575.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.46 63.36% 14894.78 12644 17242 14896.67 14325 15587 1168712 1168712 0.00
crit 45.37 36.64% 30391.90 25794 35174 30395.64 28553 32302 1378864 1378864 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 79340 18.6% 4.7 71.90sec 5108596 5527545 Periodic 162.5 106291 216828 146785 36.6% 98.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 162.49 162.49 0.9244 1.8302 23851356.23 23851356.23 0.00 79052.87 5527544.90
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.0 63.37% 106291.11 30638 173118 106328.79 100384 113124 10944640 10944640 0.00
crit 59.5 36.63% 216827.75 65445 353160 216892.57 192419 241363 12906716 12906716 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.misery.enabled&(dot.vampiric_touch.remains<3*gcd.max|dot.shadow_word_pain.remains<3*gcd.max)
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=24 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.852000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 63218 14.8% 67.8 4.27sec 280088 294871 Direct 67.6 203533 415453 281240 36.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.83 67.56 0.00 0.00 0.9499 0.0000 18999423.86 18999423.86 0.00 294871.01 294871.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.78 63.33% 203532.66 190249 228299 203540.27 195256 211811 8708113 8708113 0.00
crit 24.77 36.67% 415453.14 388108 465730 415467.42 388108 445031 10291311 10291311 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.insanity_drain_stacks.stack<6&set_bonus.tier19_4pc
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and extending the duration of Shadow Word: Pain and Vampiric Touch on all nearby targets by ${{$231688s1=3000}/1000}.1 sec][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 7130 1.7% 8.8 35.40sec 244300 0 Direct 17.5 88910 181373 122765 36.6%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.78 17.48 0.00 0.00 0.0000 0.0000 2145532.36 2145532.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.08 63.38% 88909.61 82764 99317 88893.48 82764 99317 984858 984858 0.00
crit 6.40 36.62% 181372.94 168839 202607 181162.31 0 202607 1160675 1160675 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=70|(talent.auspicious_spirits.enabled&insanity>=(65-shadowy_apparitions_in_flight*3))|set_bonus.tier19_4pc
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 24161 5.7% 5.2 62.19sec 1410276 333927 Periodic 38.1 138383 282112 190945 36.6% 6.8%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 38.08 38.08 4.2234 0.5379 7271261.45 7271261.45 0.00 333927.05 333927.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.2 63.43% 138382.83 384 165528 138334.30 122000 152460 3342488 3342488 0.00
crit 13.9 36.57% 282112.08 480 337677 281995.72 200864 328297 3928774 3928774 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains>5.5&dot.vampiric_touch.remains>5.5&!buff.power_infusion.up
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 13093 3.1% 18.8 15.66sec 209680 0 Direct 18.7 152339 310738 210380 36.6%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 18.71 0.00 0.00 0.0000 0.0000 3935332.40 3935332.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.85 63.36% 152339.07 138524 182851 152331.79 138524 182851 1805549 1805549 0.00
crit 6.85 36.64% 310738.34 282588 373017 310525.63 0 373017 2129783 2129783 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:137300.93
  • base_dd_max:137300.93
 
pet - shadowfiend 130921 / 10617
melee 130921 2.5% 28.5 7.04sec 110084 136697 Direct 28.5 80627 161217 110086 36.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.54 28.54 0.00 0.00 0.8053 0.0000 3142112.27 3142112.27 0.00 136696.78 136696.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.11 63.45% 80626.74 71784 82552 80628.20 78065 82552 1460130 1460130 0.00
crit 10.43 36.55% 161217.39 143568 165104 161223.85 143568 165104 1681982 1681982 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 47067 / 11487
Mind Flay (_void_tendril) 47067 (56247) 2.7% (4.9%) 7.5 38.68sec 846580 95618 Periodic 66.0 38286 76572 52303 36.6% 22.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.46 0.00 66.04 66.04 8.8538 1.0000 3454027.89 3454027.89 0.00 95618.01 95618.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.9 63.39% 38285.94 38286 38286 38285.94 38286 38286 1602656 1602656 0.00
crit 24.2 36.61% 76571.87 76572 76572 76571.87 76572 76572 1851371 1851371 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 47080 0.7% 1.9 88.76sec 464404 52394 Periodic 17.0 38286 76572 52395 36.8% 5.7%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.92 0.00 17.05 17.05 8.8639 1.0000 893153.75 893153.75 0.00 52393.60 52393.60
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.8 63.15% 38285.94 38286 38286 38211.41 0 38286 412183 412183 0.00
crit 6.3 36.85% 76571.87 76572 76572 75919.72 0 76572 480971 480971 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 46911 0.4% 1.1 79.13sec 462475 52373 Periodic 9.5 38286 76572 52367 36.8% 3.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.08 0.00 9.55 9.55 8.8311 1.0000 499902.89 499902.89 0.00 52373.27 52373.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.0 63.22% 38285.94 38286 38286 38045.75 0 38286 231037 231037 0.00
crit 3.5 36.78% 76571.87 76572 76572 74746.45 0 76572 268866 268866 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 47438 0.4% 1.0 121.69sec 468355 52750 Periodic 8.9 38286 76572 52744 37.8% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.01 0.00 8.95 8.95 8.8797 1.0000 471903.18 471903.18 0.00 52750.19 52750.19
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.6 62.24% 38285.94 38286 38286 38285.94 38286 38286 213183 213183 0.00
crit 3.4 37.76% 76571.87 76572 76572 75411.69 0 76572 258720 258720 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 49772 0.4% 1.0 0.00sec 497717 55302 Periodic 9.0 38286 76572 55302 44.4% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 497717.18 497717.18 0.00 55301.91 55301.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.0 55.56% 38285.94 38286 38286 38285.94 38286 38286 191430 191430 0.00
crit 4.0 44.44% 76571.87 76572 76572 76571.87 76572 76572 306287 306287 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 49772 0.4% 1.0 0.00sec 497717 55302 Periodic 9.0 38286 76572 55302 44.4% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 497717.18 497717.18 0.00 55301.91 55301.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.0 55.56% 38285.94 38286 38286 38285.94 38286 38286 191430 191430 0.00
crit 4.0 44.44% 76571.87 76572 76572 76571.87 76572 76572 306287 306287 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Waleràn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
Mental Fortitude 162.5 1.83sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 162.49 162.49 0.00 0.00 0.0000 0.0000 0.00 12031878.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.88 63.31% 0.00 0 0 0.00 0 0 0 7620323 100.00
crit 59.62 36.69% 0.00 0 0 0.00 0 0 0 4411556 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42793.13
  • base_dd_max:42793.13
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 2.6 132.58sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.shadow_word_death.charges=0&cooldown.shadow_word_death.remains>3*gcd.max&buff.voidform.stack>50
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 2.0 183.37sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9436 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&((talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60)|!talent.surrender_to_madness.enabled)
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 4.0 63.12sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 0.9130 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 11.89% 0.0(0.0) 1.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 8.8 205.7 35.4sec 35.4sec 76.06% 76.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:5.14%
  • insanity_drain_stacks_2:3.07%
  • insanity_drain_stacks_3:3.37%
  • insanity_drain_stacks_4:2.89%
  • insanity_drain_stacks_5:2.87%
  • insanity_drain_stacks_6:2.90%
  • insanity_drain_stacks_7:2.91%
  • insanity_drain_stacks_8:2.84%
  • insanity_drain_stacks_9:2.83%
  • insanity_drain_stacks_10:2.82%
  • insanity_drain_stacks_11:2.85%
  • insanity_drain_stacks_12:3.37%
  • insanity_drain_stacks_13:3.31%
  • insanity_drain_stacks_14:2.94%
  • insanity_drain_stacks_15:2.77%
  • insanity_drain_stacks_16:2.76%
  • insanity_drain_stacks_17:2.89%
  • insanity_drain_stacks_18:4.09%
  • insanity_drain_stacks_19:2.76%
  • insanity_drain_stacks_20:2.72%
  • insanity_drain_stacks_21:2.67%
  • insanity_drain_stacks_22:2.19%
  • insanity_drain_stacks_23:1.52%
  • insanity_drain_stacks_24:0.95%
  • insanity_drain_stacks_25:0.82%
  • insanity_drain_stacks_26:0.80%
  • insanity_drain_stacks_27:0.77%
  • insanity_drain_stacks_28:0.79%
  • insanity_drain_stacks_29:0.78%
  • insanity_drain_stacks_30:0.79%
  • insanity_drain_stacks_31:0.60%
  • insanity_drain_stacks_32:0.37%
  • insanity_drain_stacks_33:0.34%
  • insanity_drain_stacks_34:0.34%
  • insanity_drain_stacks_35:0.26%
  • insanity_drain_stacks_36:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 8.6 0.2 33.2sec 32.7sec 39.05% 39.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:50.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_1:1.14%
  • lingering_insanity_2:1.38%
  • lingering_insanity_3:1.14%
  • lingering_insanity_4:1.39%
  • lingering_insanity_5:1.15%
  • lingering_insanity_6:1.39%
  • lingering_insanity_7:1.15%
  • lingering_insanity_8:1.40%
  • lingering_insanity_9:1.16%
  • lingering_insanity_10:1.40%
  • lingering_insanity_11:1.16%
  • lingering_insanity_12:1.41%
  • lingering_insanity_13:1.16%
  • lingering_insanity_14:1.42%
  • lingering_insanity_15:1.17%
  • lingering_insanity_16:1.42%
  • lingering_insanity_17:1.17%
  • lingering_insanity_18:1.43%
  • lingering_insanity_19:1.18%
  • lingering_insanity_20:1.43%
  • lingering_insanity_21:1.18%
  • lingering_insanity_22:1.44%
  • lingering_insanity_23:1.19%
  • lingering_insanity_24:1.44%
  • lingering_insanity_25:1.14%
  • lingering_insanity_26:0.98%
  • lingering_insanity_27:1.08%
  • lingering_insanity_28:0.89%
  • lingering_insanity_29:0.93%
  • lingering_insanity_30:0.52%
  • lingering_insanity_31:0.36%
  • lingering_insanity_32:0.39%
  • lingering_insanity_33:0.35%
  • lingering_insanity_34:0.38%
  • lingering_insanity_35:0.03%
  • lingering_insanity_36:0.36%
  • lingering_insanity_37:0.03%
  • lingering_insanity_38:0.36%
  • lingering_insanity_39:0.00%
  • lingering_insanity_40:0.34%
  • lingering_insanity_41:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199849
  • name:Lingering Insanity
  • tooltip:
  • description:When Voidform ends, its haste bonus fades by {$s1=2}% every second, instead of ending immediately.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.0 161.5 3.8sec 1.8sec 98.70% 98.70% 161.5(161.5) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 260.8sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 2.6 0.0 132.6sec 132.6sec 16.63% 16.63% 0.0(0.0) 2.4

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:16.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 9.0 0.0 35.3sec 33.8sec 23.94% 23.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:23.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sphere of Insanity 1.0 7.8 0.0sec 35.4sec 97.32% 97.69% 7.8(7.8) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:97.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 236.5 0.0sec 0.5sec 37.30% 37.30% 236.5(236.5) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:37.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 5.2 0.0 62.3sec 62.3sec 6.81% 6.81% 0.0(0.0) 5.1

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 8.8 0.0 35.4sec 35.4sec 76.06% 72.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_3:2.91%
  • voidform_4:2.90%
  • voidform_5:2.89%
  • voidform_6:2.88%
  • voidform_7:2.87%
  • voidform_8:2.87%
  • voidform_9:2.86%
  • voidform_10:2.85%
  • voidform_11:2.84%
  • voidform_12:2.83%
  • voidform_13:2.82%
  • voidform_14:2.81%
  • voidform_15:2.80%
  • voidform_16:2.79%
  • voidform_17:2.78%
  • voidform_18:2.77%
  • voidform_19:2.76%
  • voidform_20:2.75%
  • voidform_21:2.74%
  • voidform_22:2.73%
  • voidform_23:2.69%
  • voidform_24:2.48%
  • voidform_25:2.14%
  • voidform_26:2.08%
  • voidform_27:1.91%
  • voidform_28:1.65%
  • voidform_29:1.26%
  • voidform_30:0.82%
  • voidform_31:0.76%
  • voidform_32:0.75%
  • voidform_33:0.60%
  • voidform_34:0.40%
  • voidform_35:0.39%
  • voidform_36:0.39%
  • voidform_37:0.37%
  • voidform_38:0.35%
  • voidform_39:0.34%
  • voidform_40:0.26%
  • voidform_41:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing Shadow damage you deal by {$194249s1=20}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: Shadowcrawl 4.0 0.0 63.1sec 63.1sec 83.33% 82.06% 0.0(0.0) 4.0

Buff details

  • buff initial source:Waleràn_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 125.7 2.4sec
Void Eruption casted when a target with both DoTs was up 8.8 35.4sec
Void Tendril spawned from Call to the Void 9.2 30.6sec

Resources

Resource Usage Type Count Total Average RPE APR
Waleràn
Resource Gains Type Count Total Average Overflow
Insanity Drained by Voidform Insanity 928.93 -2930.08 (-4728.84%) -3.15 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 46.03 690.24 (1113.97%) 14.99 0.26 0.04%
Insanity Gained from Mind Flay Insanity 326.45 979.35 (1580.57%) 3.00 0.00 0.00%
Insanity Gained from Power Infusion Insanity 92.00 159.44 (257.31%) 1.73 10.35 6.10%
Insanity Gained from Shadow Word: Death Insanity 6.46 63.11 (101.86%) 9.77 1.58 2.44%
Insanity Gained from Shadow Word: Pain Casts Insanity 6.10 24.38 (39.35%) 4.00 0.00 0.00%
Insanity Gained from Vampiric Touch Casts Insanity 4.67 28.01 (45.21%) 6.00 0.00 0.00%
Insanity Gained from Void Bolt Insanity 67.83 1047.51 (1690.56%) 15.44 37.84 3.49%
Health from Vampiric Touch Ticks Health 162.49 0.00 (0.00%) 0.00 11925689.50 100.00%
mp5_regen Mana 1004.05 0.00 (0.00%) 0.00 2644981.68 100.00%
Resource RPS-Gain RPS-Loss
Insanity 9.95 9.74
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 62.51 0.02 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Waleràn Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Waleràn Damage Per Second
Count 9999
Mean 426361.79
Minimum 389406.67
Maximum 465947.84
Spread ( max - min ) 76541.17
Range [ ( max - min ) / 2 * 100% ] 8.98%
Standard Deviation 9740.6291
5th Percentile 410918.14
95th Percentile 443299.71
( 95th Percentile - 5th Percentile ) 32381.57
Mean Distribution
Standard Deviation 97.4112
95.00% Confidence Intervall ( 426170.87 - 426552.71 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2005
0.1 Scale Factor Error with Delta=300 809950
0.05 Scale Factor Error with Delta=300 3239797
0.01 Scale Factor Error with Delta=300 80994902
Priority Target DPS
Sample Data Waleràn Priority Target Damage Per Second
Count 9999
Mean 426361.79
Minimum 389406.67
Maximum 465947.84
Spread ( max - min ) 76541.17
Range [ ( max - min ) / 2 * 100% ] 8.98%
Standard Deviation 9740.6291
5th Percentile 410918.14
95th Percentile 443299.71
( 95th Percentile - 5th Percentile ) 32381.57
Mean Distribution
Standard Deviation 97.4112
95.00% Confidence Intervall ( 426170.87 - 426552.71 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2005
0.1 Scale Factor Error with Delta=300 809950
0.05 Scale Factor Error with Delta=300 3239797
0.01 Scale Factor Error with Delta=300 80994902
DPS(e)
Sample Data Waleràn Damage Per Second (Effective)
Count 9999
Mean 426361.79
Minimum 389406.67
Maximum 465947.84
Spread ( max - min ) 76541.17
Range [ ( max - min ) / 2 * 100% ] 8.98%
Damage
Sample Data Waleràn Damage
Count 9999
Mean 120672657.80
Minimum 90456042.91
Maximum 152050120.43
Spread ( max - min ) 61594077.52
Range [ ( max - min ) / 2 * 100% ] 25.52%
DTPS
Sample Data Waleràn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Waleràn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Waleràn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Waleràn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Waleràn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Waleràn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data WalerànTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Waleràn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 variable,op=set,name=s2mbeltcheck,value=1,if=cooldown.mind_blast.charges>=2
7 0.00 variable,op=set,name=s2mbeltcheck,value=0,if=cooldown.mind_blast.charges<=1
8 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|(buff.voidform.stack>60&buff.power_infusion.up)
A 0.00 call_action_list,name=check,if=talent.surrender_to_madness.enabled&!buff.surrender_to_madness.up
B 0.00 run_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
C 0.00 run_action_list,name=vf,if=buff.voidform.up
D 0.00 run_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&((talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60)|!talent.surrender_to_madness.enabled)
0.00 shadow_word_pain,if=talent.misery.enabled&dot.shadow_word_pain.remains<gcd.max,moving=1,cycle_targets=1
0.00 vampiric_touch,if=talent.misery.enabled&(dot.vampiric_touch.remains<3*gcd.max|dot.shadow_word_pain.remains<3*gcd.max),cycle_targets=1
E 5.59 shadow_word_pain,if=!talent.misery.enabled&dot.shadow_word_pain.remains<(3+(4%3))*gcd
F 4.62 vampiric_touch,if=!talent.misery.enabled&dot.vampiric_touch.remains<(4+(4%3))*gcd
G 8.78 void_eruption,if=insanity>=70|(talent.auspicious_spirits.enabled&insanity>=(65-shadowy_apparitions_in_flight*3))|set_bonus.tier19_4pc
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!talent.misery.enabled&!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!talent.misery.enabled&!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
H 0.30 shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&cooldown.shadow_word_death.charges=2&insanity<=(90-20*talent.reaper_of_souls.enabled)
I 12.50 mind_blast,if=active_enemies<=4&talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=active_enemies<=4&!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=talent.shadow_word_void.enabled&(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
J 12.56 mind_flay,interrupt=1,chain=1
0.00 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 void_bolt,if=set_bonus.tier19_4pc&buff.insanity_drain_stacks.stack<6
0.00 shadow_crash,if=talent.shadow_crash.enabled
K 5.16 void_torrent,if=dot.shadow_word_pain.remains>5.5&dot.vampiric_touch.remains>5.5&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60))
0.00 mindbender,if=talent.mindbender.enabled&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30))
L 2.60 power_infusion,if=buff.insanity_drain_stacks.stack>=(10+2*set_bonus.tier19_2pc+5*buff.bloodlust.up+5*variable.s2mbeltcheck)&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+61))
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60))
M 67.83 void_bolt
N 2.25 shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+(10+20*talent.reaper_of_souls.enabled))<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.28
O 32.67 mind_blast,if=active_enemies<=4
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.28&active_enemies<=4
P 3.91 shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&cooldown.shadow_word_death.charges=2
Q 2.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=talent.shadow_word_void.enabled&(insanity-(current_insanity_drain*gcd.max)+25)<100
0.00 shadow_word_pain,if=talent.misery.enabled&dot.shadow_word_pain.remains<gcd,moving=1,cycle_targets=1
0.00 vampiric_touch,if=talent.misery.enabled&(dot.vampiric_touch.remains<3*gcd.max|dot.shadow_word_pain.remains<3*gcd.max),cycle_targets=1
R 0.51 shadow_word_pain,if=!talent.misery.enabled&!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
S 0.06 vampiric_touch,if=!talent.misery.enabled&!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
T 63.97 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(action.void_bolt.usable|(current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100&cooldown.shadow_word_death.charges>=1))
0.00 shadow_word_pain

Sample Sequence

0124578EFJIGKMTMOTMTMOQMTLMOTMTMOTMTMOTMTMOMTMOTMTIJIGTMTMOTMTMOTMTKMOTMTIEJIFGTMTMOTMTMOTMTMOJEGOTMTMOTMTKMOTMTMOJFIGTMTMOTLMTMOTMTMOTMTMOTMTMOTJEIJGTKMOTMTMOQMTMOTMTIJEFJIGTMTMOTMTMOTMTIHJIEGKMOPMT9MOTMPTMOTMTMNIFJIGTMPTMOTMLTMOPMTM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre precombat 1 food Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre precombat 2 augmentation Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre precombat 4 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre precombat 5 shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre precombat 7 s2mbeltcheck Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 precombat 8 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity potion_of_deadly_grace
0:00.000 main E shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:00.963 main F vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:01.924 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.0/100: 25% insanity bloodlust, potion_of_deadly_grace
0:06.930 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:07.892 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:07.892 vf K void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity bloodlust, sphere_of_insanity, voidform(3), insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
0:12.127 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(2), potion_of_deadly_grace, mental_fortitude
0:13.022 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:15.039 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.7/100: 75% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
0:15.910 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity bloodlust, sphere_of_insanity, voidform(11), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:16.777 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity bloodlust, sphere_of_insanity, voidform(11), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:17.645 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.5/100: 87% insanity bloodlust, sphere_of_insanity, voidform(12), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:18.500 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, sphere_of_insanity, voidform(13), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:20.616 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity bloodlust, sphere_of_insanity, voidform(15), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
0:21.450 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.5/100: 87% insanity bloodlust, sphere_of_insanity, voidform(16), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
0:22.280 vf Q shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity bloodlust, sphere_of_insanity, voidform(17), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:23.100 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.6/100: 81% insanity bloodlust, sphere_of_insanity, voidform(18), insanity_drain_stacks(13), mental_fortitude
0:23.916 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.2/100: 85% insanity bloodlust, sphere_of_insanity, voidform(19), insanity_drain_stacks(14), mental_fortitude
0:25.792 vf L power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity bloodlust, sphere_of_insanity, voidform(20), insanity_drain_stacks(15), mental_fortitude
0:25.792 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(15), mental_fortitude
0:26.541 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(16), mental_fortitude
0:27.292 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.6/100: 84% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(17), mental_fortitude
0:28.045 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.5/100: 78% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(18), mental_fortitude
0:28.802 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(18), mental_fortitude
0:29.737 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.8/100: 80% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(19), mental_fortitude
0:30.658 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(20), mental_fortitude
0:31.407 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(21), mental_fortitude
0:32.159 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.9/100: 80% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(22), mental_fortitude
0:32.913 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(23), mental_fortitude
0:33.815 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.5/100: 77% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(23), mental_fortitude
0:34.712 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(24), mental_fortitude
0:35.461 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.8/100: 81% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(25), mental_fortitude
0:36.212 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(31), insanity_drain_stacks(26), mental_fortitude
0:36.966 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(32), insanity_drain_stacks(27), mental_fortitude
0:37.841 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.2/100: 65% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(32), insanity_drain_stacks(27), mental_fortitude
0:38.711 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.4/100: 64% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(33), insanity_drain_stacks(28), mental_fortitude
0:39.462 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.7/100: 65% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(34), insanity_drain_stacks(29), mental_fortitude
0:40.556 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.3/100: 57% insanity power_infusion, sphere_of_insanity, voidform(35), insanity_drain_stacks(30), mental_fortitude
0:41.666 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.9/100: 40% insanity power_infusion, sphere_of_insanity, voidform(36), insanity_drain_stacks(31), mental_fortitude
0:42.539 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity power_infusion, sphere_of_insanity, voidform(37), insanity_drain_stacks(32), mental_fortitude
0:43.290 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.2/100: 35% insanity power_infusion, sphere_of_insanity, voidform(38), insanity_drain_stacks(33), mental_fortitude
0:44.041 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.1/100: 22% insanity power_infusion, sphere_of_insanity, voidform(39), insanity_drain_stacks(34), mental_fortitude
0:44.794 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.0/100: 21% insanity power_infusion, sphere_of_insanity, voidform(39), insanity_drain_stacks(34), mental_fortitude
0:46.410 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.1/100: 14% insanity shadowform, sphere_of_insanity, lingering_insanity(40), mental_fortitude
0:47.165 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.1/100: 29% insanity shadowform, sphere_of_insanity, lingering_insanity(38), mental_fortitude
0:51.491 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.1/100: 62% insanity shadowform, sphere_of_insanity, lingering_insanity(30), mental_fortitude
0:52.274 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity shadowform, sphere_of_insanity, lingering_insanity(28), mental_fortitude
0:52.274 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks, mental_fortitude
0:54.227 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity sphere_of_insanity, voidform(4), lingering_insanity(24), insanity_drain_stacks(2), mental_fortitude
0:55.030 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(3), mental_fortitude
0:57.119 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity sphere_of_insanity, voidform(7), lingering_insanity(18), insanity_drain_stacks(5), mental_fortitude
0:57.972 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.1/100: 92% insanity sphere_of_insanity, voidform(8), lingering_insanity(16), insanity_drain_stacks(6), mental_fortitude
0:58.849 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.6/100: 99% insanity sphere_of_insanity, voidform(9), lingering_insanity(14), insanity_drain_stacks(7), mental_fortitude
0:59.746 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.3/100: 95% insanity sphere_of_insanity, voidform(10), lingering_insanity(14), insanity_drain_stacks(8), mental_fortitude
1:00.643 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity sphere_of_insanity, voidform(11), lingering_insanity(12), insanity_drain_stacks(9), mental_fortitude
1:02.979 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity sphere_of_insanity, voidform(13), lingering_insanity(6), insanity_drain_stacks(11), mental_fortitude
1:03.959 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity sphere_of_insanity, voidform(14), lingering_insanity(4), insanity_drain_stacks(12), mental_fortitude
1:04.974 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity sphere_of_insanity, voidform(15), lingering_insanity(2), insanity_drain_stacks(13), mental_fortitude
1:06.019 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(14), mental_fortitude
1:07.089 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.9/100: 72% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(15), mental_fortitude
1:09.461 vf K void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.1/100: 45% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(18), mental_fortitude
1:13.654 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.8/100: 42% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(18), mental_fortitude
1:14.656 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.2/100: 40% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(19), mental_fortitude
1:15.654 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.9/100: 37% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(20), mental_fortitude
1:16.647 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.2/100: 24% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(21), mental_fortitude
1:17.629 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.9/100: 21% insanity sphere_of_insanity, voidform(28), insanity_drain_stacks(22), mental_fortitude
1:19.971 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.3/100: 16% insanity shadowform, sphere_of_insanity, lingering_insanity(27), mental_fortitude
1:20.783 main E shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.3/100: 31% insanity shadowform, sphere_of_insanity, lingering_insanity(27), mental_fortitude
1:21.595 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.3/100: 35% insanity shadowform, sphere_of_insanity, lingering_insanity(25), mental_fortitude
1:26.095 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity shadowform, sphere_of_insanity, lingering_insanity(15), mental_fortitude
1:27.058 main F vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.3/100: 80% insanity shadowform, sphere_of_insanity, lingering_insanity(13), mental_fortitude
1:28.051 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity shadowform, sphere_of_insanity, lingering_insanity(11), mental_fortitude
1:28.051 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity sphere_of_insanity, voidform(3), lingering_insanity(11), insanity_drain_stacks, mental_fortitude
1:30.578 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity sphere_of_insanity, voidform(5), lingering_insanity(7), insanity_drain_stacks(3), mental_fortitude
1:31.637 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity sphere_of_insanity, voidform(6), lingering_insanity(5), insanity_drain_stacks(4), mental_fortitude
1:34.005 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(6), mental_fortitude
1:35.150 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.5/100: 87% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(8), mental_fortitude
1:36.286 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(9), mental_fortitude
1:37.410 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
1:38.520 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(11), mental_fortitude
1:41.266 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(14), mental_fortitude
1:42.342 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(15), mental_fortitude
1:43.410 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.8/100: 62% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(16), mental_fortitude
1:44.466 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.6/100: 51% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(17), mental_fortitude
1:45.511 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(18), mental_fortitude
1:48.099 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.9/100: 17% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(21), mental_fortitude
1:49.114 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.3/100: 13% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(22), mental_fortitude
1:50.122 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.8/100: 25% insanity shadowform, sphere_of_insanity, lingering_insanity(24), mental_fortitude
1:56.514 main E shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.8/100: 67% insanity shadowform, sphere_of_insanity, lingering_insanity(12), mental_fortitude
1:57.521 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity shadowform, sphere_of_insanity, lingering_insanity(10), mental_fortitude
1:57.521 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity sphere_of_insanity, voidform(3), lingering_insanity(10), insanity_drain_stacks, mental_fortitude
1:58.532 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity sphere_of_insanity, voidform(4), lingering_insanity(8), insanity_drain_stacks(2), mental_fortitude
1:59.569 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity sphere_of_insanity, voidform(5), lingering_insanity(6), insanity_drain_stacks(3), mental_fortitude
2:00.633 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity sphere_of_insanity, voidform(6), lingering_insanity(4), insanity_drain_stacks(4), mental_fortitude
2:03.456 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(6), mental_fortitude
2:04.601 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(8), mental_fortitude
2:05.737 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(9), mental_fortitude
2:06.863 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
2:07.972 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.1/100: 80% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(11), mental_fortitude
2:10.439 vf K void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(13), mental_fortitude
2:14.651 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.9/100: 56% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(14), mental_fortitude
2:15.689 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(15), mental_fortitude
2:16.722 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.6/100: 56% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(16), mental_fortitude
2:17.747 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(17), mental_fortitude
2:18.760 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(18), mental_fortitude
2:21.265 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.9/100: 14% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(20), mental_fortitude
2:22.251 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(21), mental_fortitude
2:23.236 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.8/100: 21% insanity shadowform, sphere_of_insanity, lingering_insanity(28), mental_fortitude
2:27.641 main F vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.8/100: 51% insanity shadowform, sphere_of_insanity, lingering_insanity(20), mental_fortitude
2:28.536 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.8/100: 57% insanity shadowform, sphere_of_insanity, lingering_insanity(18), mental_fortitude
2:29.455 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.8/100: 72% insanity shadowform, sphere_of_insanity, lingering_insanity(16), mental_fortitude
2:29.455 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.8/100: 72% insanity sphere_of_insanity, voidform(3), lingering_insanity(16), insanity_drain_stacks, mental_fortitude
2:31.809 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity sphere_of_insanity, voidform(5), lingering_insanity(12), insanity_drain_stacks(3), mental_fortitude
2:32.776 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity sphere_of_insanity, voidform(6), lingering_insanity(10), insanity_drain_stacks(4), mental_fortitude
2:35.306 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity sphere_of_insanity, voidform(8), lingering_insanity(4), insanity_drain_stacks(6), mental_fortitude
2:36.369 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity sphere_of_insanity, voidform(9), lingering_insanity(2), insanity_drain_stacks(7), mental_fortitude
2:37.486 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(9), mental_fortitude
2:38.610 vf L power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
2:38.610 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
2:39.503 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.2/100: 84% insanity power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(11), mental_fortitude
2:41.704 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(13), mental_fortitude
2:42.571 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(14), mental_fortitude
2:43.434 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(14), mental_fortitude
2:44.298 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(15), mental_fortitude
2:45.149 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(16), mental_fortitude
2:47.256 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.8/100: 70% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(18), mental_fortitude
2:48.084 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(19), mental_fortitude
2:48.910 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.6/100: 79% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(20), mental_fortitude
2:49.731 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.6/100: 71% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(21), mental_fortitude
2:50.544 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.8/100: 75% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(22), mental_fortitude
2:52.548 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.7/100: 53% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(24), mental_fortitude
2:53.345 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.7/100: 56% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(24), mental_fortitude
2:54.137 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.1/100: 57% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(25), mental_fortitude
2:54.926 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.9/100: 47% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(26), mental_fortitude
2:55.706 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.1/100: 49% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(27), mental_fortitude
2:57.637 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.9/100: 22% insanity power_infusion, sphere_of_insanity, voidform(31), insanity_drain_stacks(29), mental_fortitude
2:58.401 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity power_infusion, sphere_of_insanity, voidform(31), insanity_drain_stacks(29), mental_fortitude
2:59.295 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.4/100: 15% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(30), mental_fortitude
3:00.242 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.3/100: 9% insanity shadowform, sphere_of_insanity, lingering_insanity(33), mental_fortitude
3:02.712 main E shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.3/100: 27% insanity shadowform, sphere_of_insanity, lingering_insanity(29), mental_fortitude
3:03.502 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.3/100: 31% insanity shadowform, sphere_of_insanity, lingering_insanity(27), mental_fortitude
3:04.315 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.3/100: 46% insanity shadowform, sphere_of_insanity, lingering_insanity(25), mental_fortitude
3:08.807 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.3/100: 76% insanity shadowform, sphere_of_insanity, lingering_insanity(17), mental_fortitude
3:08.807 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.3/100: 76% insanity sphere_of_insanity, voidform(3), lingering_insanity(17), insanity_drain_stacks, mental_fortitude
3:10.802 vf K void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.6/100: 76% insanity sphere_of_insanity, voidform(4), lingering_insanity(13), insanity_drain_stacks(2), mental_fortitude
3:15.076 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(9), lingering_insanity(3), insanity_drain_stacks(3), mental_fortitude
3:16.155 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.5/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(10), lingering_insanity, insanity_drain_stacks(4), mental_fortitude
3:17.269 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(5), mental_fortitude
3:18.393 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.1/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(6), mental_fortitude
3:19.501 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(7), mental_fortitude
3:22.246 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(10), mental_fortitude
3:23.318 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(11), mental_fortitude
3:24.387 vf Q shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(12), mental_fortitude
3:25.438 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(13), mental_fortitude
3:26.480 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(14), mental_fortitude
3:29.066 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.9/100: 38% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(17), mental_fortitude
3:30.077 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.9/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(18), mental_fortitude
3:31.084 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.3/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(19), mental_fortitude
3:32.081 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.1/100: 22% insanity twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(20), mental_fortitude
3:33.070 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.5/100: 20% insanity twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(21), mental_fortitude
3:35.434 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.9/100: 10% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(26), mental_fortitude
3:36.258 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.9/100: 25% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(26), mental_fortitude
3:39.048 main E shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.9/100: 43% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(20), mental_fortitude
3:39.942 main F vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.9/100: 47% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(18), mental_fortitude
3:40.860 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.9/100: 53% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(16), mental_fortitude
3:42.506 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.9/100: 62% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(12), mental_fortitude
3:43.513 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(10), mental_fortitude
3:43.513 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(10), insanity_drain_stacks, mental_fortitude
3:46.085 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(6), insanity_drain_stacks(3), mental_fortitude
3:47.165 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(4), insanity_drain_stacks(4), mental_fortitude
3:49.959 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(7), mental_fortitude
3:51.100 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(8), mental_fortitude
3:52.236 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(9), mental_fortitude
3:53.359 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.7/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
3:54.465 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.8/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(11), mental_fortitude
3:57.209 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.7/100: 51% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(14), mental_fortitude
3:58.279 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.5/100: 50% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(15), mental_fortitude
3:59.348 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.5/100: 49% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(16), mental_fortitude
4:00.406 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(17), mental_fortitude
4:01.449 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(18), mental_fortitude
4:04.035 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(23), mental_fortitude
4:04.892 main H shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.1/100: 27% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(23), mental_fortitude
4:05.749 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.1/100: 37% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(21), mental_fortitude
4:10.482 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.1/100: 67% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(11), mental_fortitude
4:11.505 main E shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(9), mental_fortitude
4:12.564 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.1/100: 86% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(7), mental_fortitude
4:12.564 vf K void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.1/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(7), insanity_drain_stacks, mental_fortitude
4:16.790 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.5/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(7), insanity_drain_stacks(2), mental_fortitude
4:17.953 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(8), insanity_drain_stacks(3), mental_fortitude
4:19.312 vf P shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.5/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(4), mental_fortitude
4:20.449 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(5), mental_fortitude
4:21.574 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(7), mental_fortitude
4:24.351 default 9 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(9), mental_fortitude
4:24.351 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
4:25.439 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
4:26.526 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
4:27.604 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.1/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
4:28.662 vf P shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.2/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
4:29.710 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.8/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
4:30.749 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.7/100: 57% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(16), potion_of_deadly_grace, mental_fortitude
4:31.780 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.1/100: 56% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(17), potion_of_deadly_grace, mental_fortitude
4:32.803 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.9/100: 54% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
4:33.820 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.1/100: 42% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
4:34.824 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.8/100: 40% insanity twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
4:37.309 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.8/100: 7% insanity twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(22), potion_of_deadly_grace, mental_fortitude
4:38.287 vf N shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.7/100: 3% insanity twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(23), potion_of_deadly_grace, mental_fortitude
4:39.191 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(29), potion_of_deadly_grace, mental_fortitude
4:39.983 main F vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(27), potion_of_deadly_grace, mental_fortitude
4:40.796 main J mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(27), potion_of_deadly_grace, mental_fortitude
4:45.275 main I mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(17), potion_of_deadly_grace, mental_fortitude
4:46.210 main G void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, shadowform, sphere_of_insanity, lingering_insanity(15), potion_of_deadly_grace, mental_fortitude
4:46.210 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(15), insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
4:48.318 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(11), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
4:49.293 vf P shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.3/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(9), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
4:50.296 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.3/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(7), insanity_drain_stacks(5), mental_fortitude
4:51.323 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(5), insanity_drain_stacks(6), mental_fortitude
4:52.379 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(9), lingering_insanity(3), insanity_drain_stacks(7), mental_fortitude
4:53.468 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(10), lingering_insanity, insanity_drain_stacks(8), mental_fortitude
4:54.592 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(9), mental_fortitude
4:55.713 vf L power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
4:55.713 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(10), mental_fortitude
4:57.933 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(12), mental_fortitude
4:58.806 vf O mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(13), mental_fortitude
4:59.677 vf P shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(14), mental_fortitude
5:00.539 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(15), mental_fortitude
5:01.392 vf T mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(16), mental_fortitude
5:03.498 vf M void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(18), mental_fortitude

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6259 5934 0
Agility 7825 7500 0
Stamina 43130 43130 26353
Intellect 37947 36241 27189 (880)
Spirit -1 -1 0
Health 2587800 2587800 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 37947 36241 0
Crit 36.64% 36.64% 12654
Haste 20.49% 19.49% 7310
Damage / Heal Versatility 0.89% 0.89% 423
ManaReg per Second 8800 8800 0
Mastery 31.93% 31.93% 1909
Armor 1819 1819 1819
Run Speed 7 0 502

Gear

Source Slot Average Item Level: 878.00
Local Head Illidari High Lord's Cowl
ilevel: 855, stats: { 215 Armor, +1427 Int, +2140 Sta, +848 Crit, +548 Haste }
Local Neck Pendant of the Stormforger
ilevel: 855, stats: { +1204 Sta, +1404 Crit, +829 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mother Shahraz's Seduction
ilevel: 910, stats: { 242 Armor, +2680 Sta, +1786 Int, +827 Crit, +459 Mastery }
Local Chest Robes of Celestial Adornment
ilevel: 875, stats: { 284 Armor, +2577 Sta, +1719 Int, +881 Haste, +623 Crit }, gems: { +150 Crit }
Local Waist Nethertether Cord
ilevel: 870, stats: { 157 Armor, +1231 Int, +1846 Sta, +554 Mastery, +554 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 890, stats: { 263 Armor, +2965 Sta, +1977 Int, +1103 Crit, +488 Haste }
Local Feet Norgannon's Foresight
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +735 Haste, +551 Mastery }
Local Wrists Fearless Gladiator's Satin Bracers of the Aurora
ilevel: 875, stats: { 124 Armor, +967 Int, +1450 Sta, +423 Haste, +423 Vers }
Local Hands Handwraps of Delusional Power
ilevel: 870, stats: { 175 Armor, +1846 Sta, +1231 Int, +720 Haste, +387 Crit }
Local Finger1 Seal of the Nazjatar Empire
ilevel: 865, stats: { +1321 Sta, +1558 Crit, +812 Haste }, enchant: { +200 Crit }
Local Finger2 Nightmare Loop
ilevel: 845, stats: { +1097 Sta, +1440 Crit, +660 Haste }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Trinket1 Unstable Horrorslime
ilevel: 885, stats: { +1116 Crit, +502 RunSpeed }
Local Trinket2 Eye of Skovald
ilevel: 870, stats: { +1055 Crit }
Local Back Goldscar Pelt
ilevel: 865, stats: { 137 Armor, +880 StrAgiInt, +1321 Sta, +244 Crit, +570 Haste }, gems: { +150 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 900, weapon: { 1817 - 3376, 1.8 }, stats: { +930 Int, +1395 Sta, +360 Crit, +345 Mastery, +11834 Int }, relics: { +53 ilevels, +48 ilevels, +49 ilevels }
Local Off Hand Secrets of the Void
ilevel: 900, stats: { +1221 Int, +1831 Sta, +644 Haste, +285 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Lingering Insanity (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Misery (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Shadow Crash (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Waleràn"
origin="https://eu.api.battle.net/wow/character/hyjal/Waleràn/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/196/115587524-avatar.jpg"
level=110
race=dwarf
role=spell
position=back
professions=inscription=703/engineering=704
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!0100000
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:3:773:3:774:3:775:3:776:3:777:3:778:3:779:1:1347:1:1381:3
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/variable,op=set,name=s2mbeltcheck,value=1,if=cooldown.mind_blast.charges>=2
actions.precombat+=/variable,op=set,name=s2mbeltcheck,value=0,if=cooldown.mind_blast.charges<=1
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|(buff.voidform.stack>60&buff.power_infusion.up)
actions+=/call_action_list,name=check,if=talent.surrender_to_madness.enabled&!buff.surrender_to_madness.up
actions+=/run_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/run_action_list,name=vf,if=buff.voidform.up
actions+=/run_action_list,name=main

actions.check=variable,op=set,name=actors_fight_time_mod,value=0
actions.check+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions.check+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions.check+=/variable,op=set,name=s2mcheck,value=(0.8*(83-(5*talent.sanlayn.enabled)+(33*talent.reaper_of_souls.enabled)+set_bonus.tier19_2pc*4+8*variable.s2mbeltcheck+((raw_haste_pct*10))*(2+(0.8*set_bonus.tier19_2pc)+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions.check+=/variable,op=min,name=s2mcheck,value=180

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&((talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60)|!talent.surrender_to_madness.enabled)
actions.main+=/shadow_word_pain,if=talent.misery.enabled&dot.shadow_word_pain.remains<gcd.max,moving=1,cycle_targets=1
actions.main+=/vampiric_touch,if=talent.misery.enabled&(dot.vampiric_touch.remains<3*gcd.max|dot.shadow_word_pain.remains<3*gcd.max),cycle_targets=1
actions.main+=/shadow_word_pain,if=!talent.misery.enabled&dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=!talent.misery.enabled&dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=70|(talent.auspicious_spirits.enabled&insanity>=(65-shadowy_apparitions_in_flight*3))|set_bonus.tier19_4pc
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!talent.misery.enabled&!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&cooldown.shadow_word_death.charges=2&insanity<=(90-20*talent.reaper_of_souls.enabled)
actions.main+=/mind_blast,if=active_enemies<=4&talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=active_enemies<=4&!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=talent.shadow_word_void.enabled&(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_flay,interrupt=1,chain=1
actions.main+=/shadow_word_pain

actions.s2m=void_bolt,if=buff.insanity_drain_stacks.stack<6&set_bonus.tier19_4pc
actions.s2m+=/shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/void_torrent,if=dot.shadow_word_pain.remains>5.5&dot.vampiric_touch.remains>5.5&!buff.power_infusion.up
actions.s2m+=/berserking,if=buff.voidform.stack>=65
actions.s2m+=/shadow_word_death,if=current_insanity_drain*gcd.max>insanity&!buff.power_infusion.up&(insanity-(current_insanity_drain*gcd.max)+(20+40*talent.reaper_of_souls.enabled)<100)
actions.s2m+=/power_infusion,if=cooldown.shadow_word_death.charges=0&cooldown.shadow_word_death.remains>3*gcd.max&buff.voidform.stack>50
actions.s2m+=/void_bolt
actions.s2m+=/shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+(20+40*talent.reaper_of_souls.enabled))<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.28
actions.s2m+=/dispersion,if=current_insanity_drain*gcd.max>insanity-5&!buff.power_infusion.up
actions.s2m+=/mind_blast,if=active_enemies<=5
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.28&active_enemies<=5
actions.s2m+=/shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=talent.shadow_word_void.enabled&(insanity-(current_insanity_drain*gcd.max)+50)<100
actions.s2m+=/shadow_word_pain,if=talent.misery.enabled&dot.shadow_word_pain.remains<gcd,moving=1,cycle_targets=1
actions.s2m+=/vampiric_touch,if=talent.misery.enabled&(dot.vampiric_touch.remains<3*gcd.max|dot.shadow_word_pain.remains<3*gcd.max),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!talent.misery.enabled&!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(action.void_bolt.usable|(current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+60)<100&cooldown.shadow_word_death.charges>=1))

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/void_bolt,if=set_bonus.tier19_4pc&buff.insanity_drain_stacks.stack<6
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/void_torrent,if=dot.shadow_word_pain.remains>5.5&dot.vampiric_touch.remains>5.5&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60))
actions.vf+=/mindbender,if=talent.mindbender.enabled&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30))
actions.vf+=/power_infusion,if=buff.insanity_drain_stacks.stack>=(10+2*set_bonus.tier19_2pc+5*buff.bloodlust.up+5*variable.s2mbeltcheck)&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+61))
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&(!talent.surrender_to_madness.enabled|(talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60))
actions.vf+=/void_bolt
actions.vf+=/shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+(10+20*talent.reaper_of_souls.enabled))<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.28
actions.vf+=/mind_blast,if=active_enemies<=4
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.28&active_enemies<=4
actions.vf+=/shadow_word_death,if=(active_enemies<=4|(talent.reaper_of_souls.enabled&active_enemies<=2))&cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=talent.shadow_word_void.enabled&(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=talent.misery.enabled&dot.shadow_word_pain.remains<gcd,moving=1,cycle_targets=1
actions.vf+=/vampiric_touch,if=talent.misery.enabled&(dot.vampiric_touch.remains<3*gcd.max|dot.shadow_word_pain.remains<3*gcd.max),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!talent.misery.enabled&!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!talent.misery.enabled&!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(action.void_bolt.usable|(current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100&cooldown.shadow_word_death.charges>=1))
actions.vf+=/shadow_word_pain

head=illidari_high_lords_cowl,id=139909,bonus_id=665
neck=pendant_of_the_stormforger,id=133767,bonus_id=1727/1507/3337,enchant=mark_of_the_hidden_satyr
shoulders=mother_shahrazs_seduction,id=132437,bonus_id=3459/3458
back=goldscar_pelt,id=133639,bonus_id=3414/1808/1517/3336,gems=150crit,enchant=200int
chest=robes_of_celestial_adornment,id=142410,bonus_id=3468/1808/1492,gems=150crit
wrists=fearless_gladiators_satin_bracers,id=142615,bonus_id=3462/1707/1507/3337
hands=handwraps_of_delusional_power,id=138212,bonus_id=1805/1492/3336
waist=nethertether_cord,id=139900
legs=leggings_of_the_lower_planes,id=142413,bonus_id=3468/1507/3337
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=seal_of_the_nazjatar_empire,id=134525,bonus_id=3413/1517/3337,enchant=200crit
finger2=nightmare_loop,id=121288,bonus_id=3474/1808/1507/1674,gems=150crit,enchant=200crit
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/42/1507/3337
trinket2=eye_of_skovald,id=133641,bonus_id=3416/1522/3336
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139260/140821/0,relic_id=1805:1507:3337/1805:1487/3443:1467:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=877.50
# gear_stamina=26353
# gear_intellect=27189
# gear_crit_rating=12654
# gear_haste_rating=7310
# gear_mastery_rating=1909
# gear_versatility_rating=423
# gear_speed_rating=502
# gear_armor=1819

Ptitfille

Ptitfille : 442266 dps

  • Race: Human
  • Class: Rogue
  • Spec: Assassination
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
442265.8 442265.8 328.9 / 0.074% 65337.7 / 14.8% 18274.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
24.2 24.2 Energy 42.83% 33.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ptitfille/advanced
Talents
  • 15: Master Poisoner (Assassination Rogue)
  • 30: Nightstalker
  • 45: Vigor
  • 60: Cheat Death
  • 75: Thuggee (Assassination Rogue)
  • 90: Agonizing Poison (Assassination Rogue)
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • herbalism: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ptitfille 442266
auto_attack_mh 17990 4.1% 188.4 1.60sec 28711 18167 Direct 188.4 25383 50752 28711 32.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 188.37 188.37 0.00 0.00 1.5804 0.0000 5408109.95 7950433.89 31.98 18167.10 18167.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.92 48.80% 25382.73 16763 30960 25384.02 24200 26527 2333269 3430126 31.98
crit 60.59 32.16% 50752.30 33526 61920 50755.92 47700 53625 3074841 4520307 31.98
miss 35.86 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 8908 2.0% 186.1 1.62sec 14391 9011 Direct 186.1 12704 25414 14391 32.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 186.09 186.09 0.00 0.00 1.5969 0.0000 2677875.64 3936730.85 31.98 9011.47 9011.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.66 48.72% 12703.60 8381 15480 12704.67 12153 13166 1151670 1693064 31.98
crit 60.05 32.27% 25413.64 16763 30960 25415.24 24032 26980 1526206 2243667 31.98
miss 35.37 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Envenom 66538 15.0% 36.5 8.20sec 548461 546013 Direct 36.5 414317 830067 548453 32.3% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.45 36.45 0.00 0.00 1.0045 0.0000 19993911.38 19993911.38 0.00 546013.20 546013.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.69 67.73% 414316.75 302308 536864 414538.11 369089 458708 10230212 10230212 0.00
crit 11.76 32.27% 830067.22 604616 1073728 830539.00 651438 1066158 9763699 9763699 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 11203 2.5% 145.1 3.68sec 23189 0 Direct 145.1 17538 35077 23189 32.2% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.12 145.12 0.00 0.00 0.0000 0.0000 3365146.41 3365146.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.36 67.78% 17537.75 12419 26465 17536.36 16890 17694 1725036 1725036 0.00
crit 46.76 32.22% 35076.92 24838 52930 35074.32 33562 35658 1640111 1640111 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 34966 7.9% 17.0 17.88sec 618724 615976 Periodic 149.8 53061 106100 70189 32.3% 0.0% 99.6%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.99 0.00 149.79 149.79 1.0045 2.0000 10513473.00 10513473.00 0.00 33202.71 615975.69
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.4 67.71% 53060.84 47812 94567 53087.28 50811 56098 5381169 5381169 0.00
crit 48.4 32.29% 106099.80 95624 189133 106150.98 98679 117899 5132304 5132304 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Horrific Slam 9666 2.2% 65.3 3.09sec 44532 0 Direct 65.3 33681 67359 44532 32.2% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.33 65.33 0.00 0.00 0.0000 0.0000 2909245.11 2909245.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.28 67.78% 33681.05 23862 33902 33685.47 31004 33902 1491368 1491368 0.00
crit 21.05 32.22% 67358.60 47725 67803 67346.67 0 67803 1417877 1417877 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17354.25
  • base_dd_max:19181.01
 
Insignia of Ravenholdt 19095 4.3% 169.6 3.56sec 33843 0 Direct 169.6 25593 51236 33843 32.2% 0.0%  

Stats details: insignia_of_ravenholdt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.63 169.63 0.00 0.00 0.0000 0.0000 5740785.17 5740785.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.05 67.83% 25593.11 11145 41168 25592.14 23555 27598 2944531 2944531 0.00
crit 54.58 32.17% 51236.23 22289 82336 51228.23 42891 60207 2796254 2796254 0.00
 
 

Action details: insignia_of_ravenholdt

Static Values
  • id:209043
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209043
  • name:Insignia of Ravenholdt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209041=Your attacks that generate combo points deal {$s1=15}% additional damage as Shadow to all targets within $209043A1 yards in front of you.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:65755.04
  • base_dd_max:65755.04
 
Kingsbane 33588 (48419) 7.6% (10.9%) 7.0 45.43sec 2066937 2057816 Periodic 48.0 158889 318015 210124 32.2% 0.0% 31.9%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 0.00 48.04 48.04 1.0045 2.0000 10093071.24 10093071.24 0.00 141039.76 2057815.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.6 67.80% 158889.02 57767 435700 158846.14 120411 199769 5174726 5174726 0.00
crit 15.5 32.20% 318015.22 115534 871401 317958.32 200756 461842 4918345 4918345 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.exsanguinate.enabled&dot.rupture.exsanguinated)|(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 9881 2.2% 7.0 45.43sec 421651 0 Direct 7.0 318722 636816 421634 32.4% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 7.04 0.00 0.00 0.0000 0.0000 2967497.70 2967497.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.76 67.64% 318721.88 256617 372210 318546.01 0 372210 1517200 1517200 0.00
crit 2.28 32.36% 636815.82 513233 744421 592541.25 0 744421 1450297 1450297 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 4950 1.1% 7.0 45.43sec 211164 0 Direct 7.0 159755 319203 211155 32.2% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 7.04 0.00 0.00 0.0000 0.0000 1486130.92 1486130.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.77 67.76% 159755.06 128308 186105 159629.82 0 186105 761787 761787 0.00
crit 2.27 32.24% 319203.48 256617 372210 298212.87 0 372210 724344 724344 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 8716 2.0% 16.0 18.60sec 163940 0 Direct 16.0 123973 248035 163944 32.2% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.98 15.98 0.00 0.00 0.0000 0.0000 2619036.30 2619036.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.83 67.78% 123972.62 88612 125892 123962.29 112203 125892 1342472 1342472 0.00
crit 5.15 32.22% 248034.51 177225 251785 246532.27 0 251785 1276565 1276565 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mutilate 0 (63783) 0.0% (14.4%) 84.8 3.56sec 226070 225060

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.81 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 225059.52 225059.52
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.agonizing_poison.enabled&dot.deadly_poison_dot.refreshable)|(talent.agonizing_poison.enabled&debuff.agonizing_poison.remains<debuff.agonizing_poison.duration*0.3)|(set_bonus.tier19_2pc=1&dot.mutilated_flesh.refreshable)
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 42503 9.6% 84.8 3.56sec 150639 0 Direct 84.8 109024 218061 150641 38.2% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.81 84.81 0.00 0.00 0.0000 0.0000 12776375.93 18782482.83 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.44 61.83% 109024.13 71209 131517 109019.81 103429 114660 5717515 8405289 31.98
crit 32.37 38.17% 218060.81 142418 263035 218061.92 202186 236539 7058861 10377194 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 21280 4.8% 84.8 3.56sec 75430 0 Direct 84.8 54546 109096 75431 38.3% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.81 84.81 0.00 0.00 0.0000 0.0000 6397569.75 9405033.52 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.34 61.71% 54546.18 35603 65755 54544.68 51721 57620 2855080 4197238 31.98
crit 32.47 38.29% 109096.04 71205 131510 109097.11 99675 119471 3542490 5207796 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 33488 7.6% 38.2 6.02sec 263382 0 Direct 38.2 199115 398238 263384 32.3% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.21 38.21 0.00 0.00 0.0000 0.0000 10063922.48 10063922.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.88 67.72% 199115.30 138693 200691 199123.18 183014 200691 5152678 5152678 0.00
crit 12.33 32.28% 398237.99 282522 401381 397977.32 0 401381 4911244 4911244 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 21050 4.7% 22.7 5.55sec 274185 0 Direct 22.7 207297 414771 274181 32.2% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.72 22.72 0.00 0.00 0.0000 0.0000 6229331.45 9157707.28 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.39 67.76% 207297.23 150964 214476 207280.17 188806 214476 3191276 4691478 31.98
crit 7.32 32.24% 414770.80 301928 428951 414627.42 0 428951 3038056 4466230 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 85354 19.3% 12.7 23.76sec 2014812 2005902 Periodic 148.1 119490 238887 173465 45.2% 0.0% 98.4%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 0.00 148.07 148.07 1.0045 2.0000 25685575.09 25685575.09 0.00 83137.48 2005902.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.1 54.79% 119489.56 87652 346730 119469.76 98350 149393 9694482 9694482 0.00
crit 66.9 45.21% 238886.79 175303 693461 238830.34 193886 304895 15991093 15991093 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.nightstalker.enabled&stealthed.rogue)|(talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2+artifact.urge_to_kill.enabled))))
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*8/2} over 8 sec 2 points: ${{$s1=0}*12/2} over 12 sec 3 points: ${{$s1=0}*16/2} over 16 sec 4 points: ${{$s1=0}*20/2} over 20 sec 5 points: ${{$s1=0}*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Wave 13090 3.0% 12.4 20.34sec 318482 0 Direct 12.4 240770 481437 318497 32.3% 0.0%  

Stats details: shadow_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.36 12.36 0.00 0.00 0.0000 0.0000 3936257.95 3936257.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.37 67.71% 240770.01 171617 243818 240739.62 0 243818 2014857 2014857 0.00
crit 3.99 32.29% 481437.43 343234 487636 469778.46 0 487636 1921401 1921401 0.00
 
 

Action details: shadow_wave

Static Values
  • id:215047
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215047
  • name:Shadow Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215089=Your melee attacks have a chance to unleash 4 Shadow Waves that deal {$s1=78543} Shadow damage to enemies in their path. The waves travel 15 yards away from you, and then return.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:131381.98
  • base_dd_max:131381.98
 
Simple Action Stats Execute Interval
Ptitfille
Agonizing Poison 254.8 1.30sec

Stats details: agonizing_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 254.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: agonizing_poison

Static Values
  • id:200803
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200803
  • name:Agonizing Poison
  • school:nature
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${{$200803s1=4}}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.7 135.58sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.nightstalker.enabled&combo_points>=cp_max_spend&((talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&(dot.rupture.ticking|time>10))|(!talent.exsanguinate.enabled&dot.rupture.refreshable))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.8 90.17sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.exsanguinate.enabled&cooldown.exsanguinate.remains<5&dot.rupture.ticking
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 36.39% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Envenom 26.5 10.0 11.3sec 8.2sec 65.21% 61.83% 10.0(10.0) 25.7

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:65.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 3.8 0.6 68.6sec 55.8sec 16.49% 16.49% 66.0(66.0) 3.6

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 93.4sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.7 0.0 135.4sec 135.4sec 0.11% 0.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Seal Fate 67.1 5.5sec

Resources

Resource Usage Type Count Total Average RPE APR
Ptitfille
envenom Energy 36.5 1275.9 35.0 35.0 15670.2
envenom Combo Points 36.5 168.5 4.6 4.6 118664.3
garrote Energy 17.0 764.6 45.0 45.0 13749.4
kingsbane Energy 7.0 246.3 35.0 35.0 59055.6
mutilate Energy 84.8 4664.8 55.0 55.0 4110.3
rupture Energy 12.7 318.7 25.0 25.0 80591.2
rupture Combo Points 12.7 63.7 5.0 5.0 402956.0
Resource Gains Type Count Total Average Overflow
mutilate Combo Points 84.81 166.52 (70.98%) 1.96 3.11 1.84%
kingsbane Combo Points 7.04 6.02 (2.57%) 0.86 1.02 14.49%
garrote Combo Points 16.99 15.30 (6.52%) 0.90 1.69 9.94%
energy_regen Energy 1912.70 3690.56 (51.76%) 1.93 0.35 0.01%
seal_fate Combo Points 67.12 46.77 (19.93%) 0.70 20.35 30.32%
Venomous Vim Energy 297.65 2976.48 (41.74%) 10.00 0.00 0.00%
Urge to Kill Energy 3.75 463.60 (6.50%) 123.61 174.00 27.29%
Resource RPS-Gain RPS-Loss
Energy 23.70 24.17
Combo Points 0.78 0.77
Combat End Resource Mean Min Max
Energy 30.20 0.04 151.51
Combo Points 2.33 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data Ptitfille Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Ptitfille Damage Per Second
Count 9999
Mean 442265.82
Minimum 384887.82
Maximum 521001.95
Spread ( max - min ) 136114.14
Range [ ( max - min ) / 2 * 100% ] 15.39%
Standard Deviation 16781.8566
5th Percentile 416289.28
95th Percentile 471271.51
( 95th Percentile - 5th Percentile ) 54982.23
Mean Distribution
Standard Deviation 167.8270
95.00% Confidence Intervall ( 441936.88 - 442594.75 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5532
0.1 Scale Factor Error with Delta=300 2404162
0.05 Scale Factor Error with Delta=300 9616647
0.01 Scale Factor Error with Delta=300 240416173
Priority Target DPS
Sample Data Ptitfille Priority Target Damage Per Second
Count 9999
Mean 442265.82
Minimum 384887.82
Maximum 521001.95
Spread ( max - min ) 136114.14
Range [ ( max - min ) / 2 * 100% ] 15.39%
Standard Deviation 16781.8566
5th Percentile 416289.28
95th Percentile 471271.51
( 95th Percentile - 5th Percentile ) 54982.23
Mean Distribution
Standard Deviation 167.8270
95.00% Confidence Intervall ( 441936.88 - 442594.75 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5532
0.1 Scale Factor Error with Delta=300 2404162
0.05 Scale Factor Error with Delta=300 9616647
0.01 Scale Factor Error with Delta=300 240416173
DPS(e)
Sample Data Ptitfille Damage Per Second (Effective)
Count 9999
Mean 442265.82
Minimum 384887.82
Maximum 521001.95
Spread ( max - min ) 136114.14
Range [ ( max - min ) / 2 * 100% ] 15.39%
Damage
Sample Data Ptitfille Damage
Count 9999
Mean 132863315.46
Minimum 96797716.85
Maximum 172965649.03
Spread ( max - min ) 76167932.18
Range [ ( max - min ) / 2 * 100% ] 28.66%
DTPS
Sample Data Ptitfille Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ptitfille Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ptitfille Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ptitfille Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ptitfille Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ptitfille Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data PtitfilleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ptitfille Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=cds
9 0.00 call_action_list,name=maintain
A 0.00 call_action_list,name=finish,if=(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)&(!dot.rupture.refreshable|(dot.rupture.exsanguinated&dot.rupture.remains>=3.5)|target.time_to_die-dot.rupture.remains<=4)&active_dot.rupture>=spell_targets.rupture
The 'active_dot.rupture>=spell_targets.rupture' means that we don't want to envenom as long as we can multi-rupture (i.e. units that don't have rupture yet).
B 0.00 call_action_list,name=build,if=(combo_points.deficit>0|energy.time_to_max<1)
actions.build Builders
# count action,conditions
0.00 hemorrhage,if=refreshable
0.00 hemorrhage,cycle_targets=1,if=refreshable&dot.rupture.ticking&spell_targets.fan_of_knives<=3
0.00 fan_of_knives,if=spell_targets>=3|buff.the_dreadlords_deceit.stack>=29
C 0.74 mutilate,cycle_targets=1,if=(!talent.agonizing_poison.enabled&dot.deadly_poison_dot.refreshable)|(talent.agonizing_poison.enabled&debuff.agonizing_poison.remains<debuff.agonizing_poison.duration*0.3)|(set_bonus.tier19_2pc=1&dot.mutilated_flesh.refreshable)
D 84.08 mutilate
actions.cds Cooldowns
# count action,conditions
E 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
0.00 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
0.00 vendetta,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<5&dot.rupture.ticking
0.00 vendetta,if=talent.exsanguinate.enabled&(artifact.master_assassin.rank>=4-equipped.convergence_of_fates|equipped.duskwalkers_footpads)&energy.deficit>=75&!(artifact.master_assassin.rank=5-equipped.convergence_of_fates&equipped.duskwalkers_footpads)
F 3.75 vendetta,if=!talent.exsanguinate.enabled&energy.deficit>=88-!talent.venom_rush.enabled*10
G 2.70 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&((talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&(dot.rupture.ticking|time>10))|(!talent.exsanguinate.enabled&dot.rupture.refreshable))
0.00 vanish,if=talent.subterfuge.enabled&dot.garrote.refreshable&((spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives)|(spell_targets.fan_of_knives>=4&combo_points.deficit>=4))
0.00 vanish,if=talent.shadow_focus.enabled&energy.time_to_max>=2&combo_points.deficit>=4
0.00 exsanguinate,if=prev_gcd.1.rupture&dot.rupture.remains>4+4*cp_max_spend
actions.finish Finishers
# count action,conditions
0.00 death_from_above,if=combo_points>=cp_max_spend
H 36.45 envenom,if=combo_points>=4|(talent.elaborate_planning.enabled&combo_points>=3+!talent.exsanguinate.enabled&buff.elaborate_planning.remains<0.1)
actions.maintain Maintain
# count action,conditions
I 2.65 rupture,if=(talent.nightstalker.enabled&stealthed.rogue)|(talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2+artifact.urge_to_kill.enabled))))
J 10.10 rupture,cycle_targets=1,if=combo_points>=cp_max_spend-talent.exsanguinate.enabled&refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4
K 7.04 kingsbane,if=(talent.exsanguinate.enabled&dot.rupture.exsanguinated)|(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))
0.00 pool_resource,for_next=1
L 16.99 garrote,cycle_targets=1,if=refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4

Sample Sequence

012456LCGIDFKHDDHDDHDLHDDJDDHDLHDDHDDJDKLHDDHDDJLDHDDHDDLHDDFEDJKDHDDLHDDHDDDJLDDHDDHDLKGIDDHDHDLDHDDJDDLHDDFHDDKJDDLHDHDDHDLDJDDHDDHLDKJDDHDDLHDDHDDGILDHDDFHDDHKDHLDDJDHDHDD

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Ptitfille 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation Ptitfille 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food Ptitfille 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 apply_poison Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 potion Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, potion_of_the_old_war
0:00.000 maintain L garrote Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, potion_of_the_old_war
0:01.005 build C mutilate Fluffy_Pillow 140.4/170: 83% energy | 1.0/5: 20% combo_points bloodlust, potion_of_the_old_war
0:02.011 cds G vanish Fluffy_Pillow 110.9/170: 65% energy | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:02.011 maintain I rupture Fluffy_Pillow 110.9/170: 65% energy | 5.0/5: 100% combo_points bloodlust, vanish, potion_of_the_old_war
0:03.015 build D mutilate Fluffy_Pillow 101.3/170: 60% energy | 0.0/5: 0% combo_points bloodlust, potion_of_the_old_war
0:04.020 cds F vendetta Fluffy_Pillow 81.7/170: 48% energy | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:04.020 maintain K kingsbane Fluffy_Pillow 170.0/170: 100% energy | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:05.024 finish H envenom Fluffy_Pillow 150.4/170: 88% energy | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:06.026 build D mutilate Fluffy_Pillow 150.8/170: 89% energy | 0.0/5: 0% combo_points bloodlust, envenom, potion_of_the_old_war
0:07.032 build D mutilate Fluffy_Pillow 111.2/170: 65% energy | 2.0/5: 40% combo_points bloodlust, envenom, potion_of_the_old_war
0:08.036 finish H envenom Fluffy_Pillow 91.6/170: 54% energy | 4.0/5: 80% combo_points bloodlust, envenom, potion_of_the_old_war
0:09.039 build D mutilate Fluffy_Pillow 72.0/170: 42% energy | 0.0/5: 0% combo_points bloodlust, envenom, potion_of_the_old_war
0:10.044 Waiting     0.200 sec 52.5/170: 31% energy | 2.0/5: 40% combo_points bloodlust, envenom, potion_of_the_old_war
0:10.244 build D mutilate Fluffy_Pillow 55.5/170: 33% energy | 2.0/5: 40% combo_points bloodlust, envenom, potion_of_the_old_war
0:11.249 Waiting     0.789 sec 15.9/170: 9% energy | 4.0/5: 80% combo_points bloodlust, envenom, potion_of_the_old_war
0:12.038 finish H envenom Fluffy_Pillow 48.1/170: 28% energy | 4.0/5: 80% combo_points bloodlust, envenom, potion_of_the_old_war
0:13.043 Waiting     1.000 sec 28.5/170: 17% energy | 0.0/5: 0% combo_points bloodlust, envenom, potion_of_the_old_war
0:14.043 build D mutilate Fluffy_Pillow 63.8/170: 38% energy | 0.0/5: 0% combo_points bloodlust, envenom, potion_of_the_old_war
0:16.069 maintain L garrote Fluffy_Pillow 59.9/170: 35% energy | 4.0/5: 80% combo_points bloodlust, envenom, potion_of_the_old_war
0:17.075 Waiting     0.400 sec 30.4/170: 18% energy | 5.0/5: 100% combo_points bloodlust, envenom, potion_of_the_old_war
0:17.475 finish H envenom Fluffy_Pillow 36.5/170: 21% energy | 5.0/5: 100% combo_points bloodlust, envenom, potion_of_the_old_war
0:18.481 Waiting     1.200 sec 36.9/170: 22% energy | 0.0/5: 0% combo_points bloodlust, envenom, potion_of_the_old_war
0:19.681 build D mutilate Fluffy_Pillow 55.4/170: 33% energy | 0.0/5: 0% combo_points bloodlust, envenom, potion_of_the_old_war
0:20.687 Waiting     1.300 sec 35.8/170: 21% energy | 2.0/5: 40% combo_points bloodlust, envenom, potion_of_the_old_war
0:21.987 build D mutilate Fluffy_Pillow 55.7/170: 33% energy | 2.0/5: 40% combo_points bloodlust, envenom, potion_of_the_old_war
0:22.991 maintain J rupture Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points bloodlust, envenom, potion_of_the_old_war
0:23.994 Waiting     0.600 sec 26.6/170: 16% energy | 0.0/5: 0% combo_points bloodlust, envenom
0:24.594 build D mutilate Fluffy_Pillow 55.8/170: 33% energy | 0.0/5: 0% combo_points bloodlust
0:25.598 Waiting     1.275 sec 16.2/170: 10% energy | 3.0/5: 60% combo_points bloodlust
0:26.873 build D mutilate Fluffy_Pillow 55.7/170: 33% energy | 3.0/5: 60% combo_points bloodlust
0:27.879 Waiting     0.574 sec 16.2/170: 10% energy | 5.0/5: 100% combo_points bloodlust
0:28.453 finish H envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points bloodlust
0:29.456 Waiting     0.700 sec 25.4/170: 15% energy | 0.0/5: 0% combo_points bloodlust, envenom
0:30.156 build D mutilate Fluffy_Pillow 56.1/170: 33% energy | 0.0/5: 0% combo_points bloodlust, envenom
0:32.182 maintain L garrote Fluffy_Pillow 52.2/170: 31% energy | 3.0/5: 60% combo_points bloodlust, envenom
0:33.184 Waiting     0.856 sec 22.6/170: 13% energy | 4.0/5: 80% combo_points bloodlust, envenom
0:34.040 finish H envenom Fluffy_Pillow 55.7/170: 33% energy | 4.0/5: 80% combo_points bloodlust, envenom
0:35.046 Waiting     1.000 sec 36.2/170: 21% energy | 0.0/5: 0% combo_points bloodlust, envenom
0:36.046 build D mutilate Fluffy_Pillow 71.5/170: 42% energy | 0.0/5: 0% combo_points bloodlust, envenom
0:37.050 Waiting     1.000 sec 31.9/170: 19% energy | 2.0/5: 40% combo_points bloodlust, envenom
0:38.050 build D mutilate Fluffy_Pillow 67.3/170: 40% energy | 2.0/5: 40% combo_points bloodlust, envenom
0:39.053 Waiting     0.500 sec 27.7/170: 16% energy | 4.0/5: 80% combo_points bloodlust, envenom
0:39.553 finish H envenom Fluffy_Pillow 35.3/170: 21% energy | 4.0/5: 80% combo_points bloodlust
0:40.558 Waiting     1.500 sec 32.2/170: 19% energy | 0.0/5: 0% combo_points envenom
0:42.058 build D mutilate Fluffy_Pillow 69.9/170: 41% energy | 0.0/5: 0% combo_points envenom
0:43.063 Waiting     1.000 sec 26.8/170: 16% energy | 3.0/5: 60% combo_points envenom
0:44.063 build D mutilate Fluffy_Pillow 58.6/170: 34% energy | 3.0/5: 60% combo_points envenom
0:45.067 Waiting     0.909 sec 15.4/170: 9% energy | 5.0/5: 100% combo_points
0:45.976 maintain J rupture Fluffy_Pillow 26.2/170: 15% energy | 5.0/5: 100% combo_points
0:46.979 Waiting     1.100 sec 33.0/170: 19% energy | 0.0/5: 0% combo_points
0:48.079 build D mutilate Fluffy_Pillow 66.0/170: 39% energy | 0.0/5: 0% combo_points
0:50.102 maintain K kingsbane Fluffy_Pillow 54.9/170: 32% energy | 3.0/5: 60% combo_points
0:52.128 maintain L garrote Fluffy_Pillow 63.8/170: 38% energy | 4.0/5: 80% combo_points
0:53.134 Waiting     0.400 sec 30.7/170: 18% energy | 5.0/5: 100% combo_points
0:53.534 finish H envenom Fluffy_Pillow 35.4/170: 21% energy | 5.0/5: 100% combo_points
0:54.540 Waiting     1.500 sec 32.3/170: 19% energy | 0.0/5: 0% combo_points envenom
0:56.040 build D mutilate Fluffy_Pillow 70.0/170: 41% energy | 0.0/5: 0% combo_points envenom
0:57.044 Waiting     1.000 sec 26.8/170: 16% energy | 2.0/5: 40% combo_points envenom
0:58.044 build D mutilate Fluffy_Pillow 58.6/170: 34% energy | 2.0/5: 40% combo_points envenom
0:59.048 Waiting     1.004 sec 15.5/170: 9% energy | 5.0/5: 100% combo_points envenom
1:00.052 finish H envenom Fluffy_Pillow 47.4/170: 28% energy | 5.0/5: 100% combo_points
1:01.057 Waiting     1.000 sec 24.2/170: 14% energy | 0.0/5: 0% combo_points envenom
1:02.057 build D mutilate Fluffy_Pillow 56.0/170: 33% energy | 0.0/5: 0% combo_points envenom
1:03.062 Waiting     1.926 sec 12.9/170: 8% energy | 3.0/5: 60% combo_points envenom
1:04.988 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 3.0/5: 60% combo_points envenom
1:05.994 Waiting     1.058 sec 12.5/170: 7% energy | 5.0/5: 100% combo_points envenom
1:07.052 maintain J rupture Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points
1:08.056 maintain L garrote Fluffy_Pillow 51.8/170: 30% energy | 0.0/5: 0% combo_points
1:09.059 Waiting     1.434 sec 18.7/170: 11% energy | 1.0/5: 20% combo_points
1:10.493 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 1.0/5: 20% combo_points
1:11.497 Waiting     1.061 sec 12.5/170: 7% energy | 4.0/5: 80% combo_points
1:12.558 finish H envenom Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points
1:13.561 Waiting     1.168 sec 21.8/170: 13% energy | 0.0/5: 0% combo_points envenom
1:14.729 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points envenom
1:15.732 Waiting     1.961 sec 12.5/170: 7% energy | 2.0/5: 40% combo_points envenom
1:17.693 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 2.0/5: 40% combo_points
1:18.697 Waiting     0.300 sec 32.5/170: 19% energy | 4.0/5: 80% combo_points
1:18.997 finish H envenom Fluffy_Pillow 36.0/170: 21% energy | 4.0/5: 80% combo_points
1:20.004 Waiting     1.877 sec 22.9/170: 13% energy | 0.0/5: 0% combo_points envenom
1:21.881 build D mutilate Fluffy_Pillow 55.1/170: 32% energy | 0.0/5: 0% combo_points envenom
1:22.885 Waiting     1.200 sec 31.9/170: 19% energy | 2.0/5: 40% combo_points envenom
1:24.085 build D mutilate Fluffy_Pillow 66.1/170: 39% energy | 2.0/5: 40% combo_points
1:26.112 maintain L garrote Fluffy_Pillow 55.0/170: 32% energy | 5.0/5: 100% combo_points
1:27.118 Waiting     0.963 sec 21.9/170: 13% energy | 5.0/5: 100% combo_points
1:28.081 finish H envenom Fluffy_Pillow 53.3/170: 31% energy | 5.0/5: 100% combo_points
1:29.085 Waiting     1.000 sec 30.1/170: 18% energy | 0.0/5: 0% combo_points envenom
1:30.085 build D mutilate Fluffy_Pillow 61.9/170: 36% energy | 0.0/5: 0% combo_points envenom
1:31.089 Waiting     1.428 sec 18.8/170: 11% energy | 2.0/5: 40% combo_points envenom, horrific_appendages
1:32.517 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 2.0/5: 40% combo_points envenom, horrific_appendages
1:33.520 Waiting     1.061 sec 12.5/170: 7% energy | 4.0/5: 80% combo_points envenom, horrific_appendages
1:34.581 cds F vendetta Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points horrific_appendages
1:34.581 cds E potion Fluffy_Pillow 170.0/170: 100% energy | 4.0/5: 80% combo_points horrific_appendages
1:34.581 build D mutilate Fluffy_Pillow 170.0/170: 100% energy | 4.0/5: 80% combo_points horrific_appendages, potion_of_the_old_war
1:35.585 maintain J rupture Fluffy_Pillow 126.9/170: 75% energy | 5.0/5: 100% combo_points horrific_appendages, potion_of_the_old_war
1:36.589 maintain K kingsbane Fluffy_Pillow 133.7/170: 79% energy | 0.0/5: 0% combo_points horrific_appendages, potion_of_the_old_war
1:37.592 build D mutilate Fluffy_Pillow 110.5/170: 65% energy | 1.0/5: 20% combo_points horrific_appendages, potion_of_the_old_war
1:38.596 finish H envenom Fluffy_Pillow 87.4/170: 51% energy | 4.0/5: 80% combo_points horrific_appendages, potion_of_the_old_war
1:39.599 build D mutilate Fluffy_Pillow 64.2/170: 38% energy | 0.0/5: 0% combo_points envenom, horrific_appendages, potion_of_the_old_war
1:40.603 Waiting     1.200 sec 41.1/170: 24% energy | 3.0/5: 60% combo_points envenom, horrific_appendages, potion_of_the_old_war
1:41.803 build D mutilate Fluffy_Pillow 55.3/170: 33% energy | 3.0/5: 60% combo_points envenom, horrific_appendages, potion_of_the_old_war
1:44.083 maintain L garrote Fluffy_Pillow 67.2/170: 40% energy | 5.0/5: 100% combo_points potion_of_the_old_war
1:45.087 Waiting     0.100 sec 34.0/170: 20% energy | 5.0/5: 100% combo_points potion_of_the_old_war
1:45.187 finish H envenom Fluffy_Pillow 35.2/170: 21% energy | 5.0/5: 100% combo_points potion_of_the_old_war
1:46.192 Waiting     1.900 sec 32.1/170: 19% energy | 0.0/5: 0% combo_points envenom, potion_of_the_old_war
1:48.092 build D mutilate Fluffy_Pillow 74.5/170: 44% energy | 0.0/5: 0% combo_points envenom, potion_of_the_old_war
1:49.096 Waiting     1.000 sec 31.4/170: 18% energy | 3.0/5: 60% combo_points envenom, potion_of_the_old_war
1:50.096 build D mutilate Fluffy_Pillow 63.2/170: 37% energy | 3.0/5: 60% combo_points envenom, potion_of_the_old_war
1:51.099 Waiting     0.922 sec 20.0/170: 12% energy | 5.0/5: 100% combo_points envenom, potion_of_the_old_war
1:52.021 finish H envenom Fluffy_Pillow 50.9/170: 30% energy | 5.0/5: 100% combo_points potion_of_the_old_war
1:53.025 Waiting     1.000 sec 27.7/170: 16% energy | 0.0/5: 0% combo_points envenom, potion_of_the_old_war
1:54.025 build D mutilate Fluffy_Pillow 59.6/170: 35% energy | 0.0/5: 0% combo_points envenom, potion_of_the_old_war
1:55.030 Waiting     1.627 sec 16.4/170: 10% energy | 2.0/5: 40% combo_points envenom, potion_of_the_old_war
1:56.657 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 2.0/5: 40% combo_points envenom, potion_of_the_old_war
1:57.662 Waiting     1.959 sec 12.5/170: 7% energy | 4.0/5: 80% combo_points envenom, potion_of_the_old_war
1:59.621 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 4.0/5: 80% combo_points
2:00.626 maintain J rupture Fluffy_Pillow 32.5/170: 19% energy | 5.0/5: 100% combo_points
2:02.136 maintain L garrote Fluffy_Pillow 45.3/170: 27% energy | 0.0/5: 0% combo_points
2:03.141 Waiting     1.986 sec 12.2/170: 7% energy | 1.0/5: 20% combo_points
2:05.127 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 1.0/5: 20% combo_points
2:06.133 Waiting     1.900 sec 32.5/170: 19% energy | 3.0/5: 60% combo_points
2:08.033 build D mutilate Fluffy_Pillow 74.9/170: 44% energy | 3.0/5: 60% combo_points
2:09.038 Waiting     0.300 sec 31.8/170: 19% energy | 5.0/5: 100% combo_points
2:09.338 finish H envenom Fluffy_Pillow 35.3/170: 21% energy | 5.0/5: 100% combo_points
2:10.342 Waiting     1.700 sec 32.2/170: 19% energy | 0.0/5: 0% combo_points envenom
2:12.042 build D mutilate Fluffy_Pillow 72.3/170: 43% energy | 0.0/5: 0% combo_points envenom
2:13.046 Waiting     1.000 sec 29.1/170: 17% energy | 3.0/5: 60% combo_points envenom
2:14.046 build D mutilate Fluffy_Pillow 60.9/170: 36% energy | 3.0/5: 60% combo_points envenom
2:15.050 Waiting     1.012 sec 17.8/170: 10% energy | 5.0/5: 100% combo_points envenom
2:16.062 finish H envenom Fluffy_Pillow 49.7/170: 29% energy | 5.0/5: 100% combo_points
2:17.066 Waiting     1.000 sec 26.6/170: 16% energy | 0.0/5: 0% combo_points envenom
2:18.066 build D mutilate Fluffy_Pillow 58.4/170: 34% energy | 0.0/5: 0% combo_points envenom
2:20.092 maintain L garrote Fluffy_Pillow 47.3/170: 28% energy | 3.0/5: 60% combo_points envenom
2:21.095 Waiting     0.920 sec 14.1/170: 8% energy | 4.0/5: 80% combo_points envenom
2:22.015 maintain K kingsbane Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points envenom
2:23.018 cds G vanish Fluffy_Pillow 21.8/170: 13% energy | 5.0/5: 100% combo_points
2:23.018 Waiting     0.367 sec 21.8/170: 13% energy | 5.0/5: 100% combo_points vanish
2:23.385 maintain I rupture Fluffy_Pillow 26.2/170: 15% energy | 5.0/5: 100% combo_points vanish
2:24.389 Waiting     1.700 sec 33.0/170: 19% energy | 0.0/5: 0% combo_points
2:26.089 build D mutilate Fluffy_Pillow 73.1/170: 43% energy | 0.0/5: 0% combo_points
2:27.094 Waiting     1.000 sec 30.0/170: 18% energy | 3.0/5: 60% combo_points
2:28.094 build D mutilate Fluffy_Pillow 61.8/170: 36% energy | 3.0/5: 60% combo_points
2:29.098 Waiting     0.940 sec 18.6/170: 11% energy | 5.0/5: 100% combo_points
2:30.038 finish H envenom Fluffy_Pillow 49.7/170: 29% energy | 5.0/5: 100% combo_points
2:31.043 Waiting     1.000 sec 26.6/170: 16% energy | 0.0/5: 0% combo_points envenom
2:32.043 build D mutilate Fluffy_Pillow 58.4/170: 34% energy | 0.0/5: 0% combo_points envenom
2:33.047 Waiting     1.026 sec 15.2/170: 9% energy | 4.0/5: 80% combo_points envenom
2:34.073 finish H envenom Fluffy_Pillow 47.3/170: 28% energy | 4.0/5: 80% combo_points envenom, horrific_appendages
2:35.077 Waiting     1.000 sec 24.2/170: 14% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
2:36.077 build D mutilate Fluffy_Pillow 56.0/170: 33% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
2:38.356 maintain L garrote Fluffy_Pillow 47.9/170: 28% energy | 2.0/5: 40% combo_points envenom, horrific_appendages
2:39.361 Waiting     1.765 sec 14.8/170: 9% energy | 3.0/5: 60% combo_points envenom, horrific_appendages
2:41.126 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 3.0/5: 60% combo_points horrific_appendages
2:42.131 Waiting     0.300 sec 32.5/170: 19% energy | 5.0/5: 100% combo_points horrific_appendages
2:42.431 finish H envenom Fluffy_Pillow 36.0/170: 21% energy | 5.0/5: 100% combo_points horrific_appendages
2:43.434 Waiting     1.927 sec 12.9/170: 8% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
2:45.361 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
2:46.367 Waiting     1.700 sec 32.5/170: 19% energy | 3.0/5: 60% combo_points envenom
2:48.067 build D mutilate Fluffy_Pillow 72.6/170: 43% energy | 3.0/5: 60% combo_points envenom
2:49.071 maintain J rupture Fluffy_Pillow 29.4/170: 17% energy | 5.0/5: 100% combo_points
2:50.078 Waiting     1.600 sec 36.3/170: 21% energy | 0.0/5: 0% combo_points
2:51.678 build D mutilate Fluffy_Pillow 55.2/170: 32% energy | 0.0/5: 0% combo_points
2:52.682 Waiting     1.400 sec 32.0/170: 19% energy | 3.0/5: 60% combo_points
2:54.082 build D mutilate Fluffy_Pillow 68.6/170: 40% energy | 3.0/5: 60% combo_points
2:56.110 maintain L garrote Fluffy_Pillow 57.5/170: 34% energy | 5.0/5: 100% combo_points
2:57.115 Waiting     0.900 sec 24.4/170: 14% energy | 5.0/5: 100% combo_points
2:58.015 finish H envenom Fluffy_Pillow 55.0/170: 32% energy | 5.0/5: 100% combo_points
2:59.020 Waiting     1.000 sec 31.9/170: 19% energy | 0.0/5: 0% combo_points envenom
3:00.020 build D mutilate Fluffy_Pillow 63.7/170: 37% energy | 0.0/5: 0% combo_points envenom
3:01.025 Waiting     1.277 sec 20.5/170: 12% energy | 2.0/5: 40% combo_points envenom
3:02.302 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 2.0/5: 40% combo_points envenom
3:03.306 Waiting     1.061 sec 12.5/170: 7% energy | 4.0/5: 80% combo_points envenom
3:04.367 cds F vendetta Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points
3:04.581 finish H envenom Fluffy_Pillow 170.0/170: 100% energy | 4.0/5: 80% combo_points
3:05.585 build D mutilate Fluffy_Pillow 146.9/170: 86% energy | 0.0/5: 0% combo_points envenom
3:06.587 build D mutilate Fluffy_Pillow 123.7/170: 73% energy | 2.0/5: 40% combo_points envenom
3:07.591 maintain K kingsbane Fluffy_Pillow 80.5/170: 47% energy | 4.0/5: 80% combo_points envenom
3:08.595 maintain J rupture Fluffy_Pillow 77.4/170: 46% energy | 5.0/5: 100% combo_points envenom
3:09.599 build D mutilate Fluffy_Pillow 64.2/170: 38% energy | 0.0/5: 0% combo_points
3:10.604 Waiting     1.200 sec 41.1/170: 24% energy | 2.0/5: 40% combo_points
3:11.804 build D mutilate Fluffy_Pillow 55.3/170: 33% energy | 2.0/5: 40% combo_points
3:14.082 maintain L garrote Fluffy_Pillow 67.2/170: 40% energy | 4.0/5: 80% combo_points
3:15.086 Waiting     0.100 sec 34.0/170: 20% energy | 5.0/5: 100% combo_points
3:15.186 finish H envenom Fluffy_Pillow 35.2/170: 21% energy | 5.0/5: 100% combo_points
3:16.191 Waiting     1.900 sec 32.1/170: 19% energy | 0.0/5: 0% combo_points envenom
3:18.091 build D mutilate Fluffy_Pillow 74.5/170: 44% energy | 0.0/5: 0% combo_points envenom
3:19.097 Waiting     0.400 sec 31.4/170: 18% energy | 4.0/5: 80% combo_points envenom
3:19.497 finish H envenom Fluffy_Pillow 36.1/170: 21% energy | 4.0/5: 80% combo_points envenom
3:20.501 Waiting     1.500 sec 32.9/170: 19% energy | 0.0/5: 0% combo_points envenom
3:22.001 build D mutilate Fluffy_Pillow 60.7/170: 36% energy | 0.0/5: 0% combo_points envenom
3:23.003 Waiting     1.100 sec 27.5/170: 16% energy | 2.0/5: 40% combo_points envenom
3:24.103 build D mutilate Fluffy_Pillow 60.5/170: 36% energy | 2.0/5: 40% combo_points envenom
3:25.109 Waiting     0.948 sec 17.3/170: 10% energy | 5.0/5: 100% combo_points envenom
3:26.057 finish H envenom Fluffy_Pillow 48.5/170: 29% energy | 5.0/5: 100% combo_points
3:27.063 Waiting     1.000 sec 25.4/170: 15% energy | 0.0/5: 0% combo_points envenom
3:28.063 build D mutilate Fluffy_Pillow 57.2/170: 34% energy | 0.0/5: 0% combo_points envenom
3:29.067 Waiting     1.625 sec 14.1/170: 8% energy | 3.0/5: 60% combo_points envenom
3:30.692 maintain L garrote Fluffy_Pillow 53.3/170: 31% energy | 3.0/5: 60% combo_points envenom
3:31.696 Waiting     1.313 sec 20.1/170: 12% energy | 4.0/5: 80% combo_points envenom
3:33.009 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 4.0/5: 80% combo_points
3:34.013 maintain J rupture Fluffy_Pillow 32.5/170: 19% energy | 5.0/5: 100% combo_points
3:35.016 Waiting     1.382 sec 19.3/170: 11% energy | 0.0/5: 0% combo_points
3:36.398 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points
3:37.402 Waiting     1.960 sec 12.5/170: 7% energy | 3.0/5: 60% combo_points
3:39.362 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 3.0/5: 60% combo_points horrific_appendages
3:40.368 Waiting     0.300 sec 32.5/170: 19% energy | 5.0/5: 100% combo_points horrific_appendages
3:40.668 finish H envenom Fluffy_Pillow 36.0/170: 21% energy | 5.0/5: 100% combo_points horrific_appendages
3:41.672 Waiting     1.925 sec 12.9/170: 8% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
3:43.597 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
3:44.601 Waiting     1.400 sec 32.5/170: 19% energy | 3.0/5: 60% combo_points envenom, horrific_appendages
3:46.001 build D mutilate Fluffy_Pillow 59.0/170: 35% energy | 3.0/5: 60% combo_points envenom, horrific_appendages
3:47.007 Waiting     0.800 sec 25.9/170: 15% energy | 5.0/5: 100% combo_points horrific_appendages
3:47.807 finish H envenom Fluffy_Pillow 35.3/170: 21% energy | 5.0/5: 100% combo_points horrific_appendages
3:50.088 maintain L garrote Fluffy_Pillow 67.2/170: 40% energy | 0.0/5: 0% combo_points envenom
3:51.094 Waiting     1.000 sec 34.1/170: 20% energy | 1.0/5: 20% combo_points envenom
3:52.094 build D mutilate Fluffy_Pillow 65.9/170: 39% energy | 1.0/5: 20% combo_points envenom
3:53.097 Waiting     0.988 sec 22.8/170: 13% energy | 5.0/5: 100% combo_points envenom, horrific_appendages
3:54.085 maintain K kingsbane Fluffy_Pillow 54.4/170: 32% energy | 5.0/5: 100% combo_points horrific_appendages
3:55.090 maintain J rupture Fluffy_Pillow 31.3/170: 18% energy | 5.0/5: 100% combo_points horrific_appendages
3:56.095 Waiting     1.500 sec 38.2/170: 22% energy | 0.0/5: 0% combo_points horrific_appendages
3:57.595 build D mutilate Fluffy_Pillow 55.9/170: 33% energy | 0.0/5: 0% combo_points horrific_appendages
3:58.598 Waiting     1.500 sec 32.7/170: 19% energy | 2.0/5: 40% combo_points horrific_appendages
4:00.098 build D mutilate Fluffy_Pillow 70.4/170: 41% energy | 2.0/5: 40% combo_points horrific_appendages
4:01.103 Waiting     0.700 sec 27.3/170: 16% energy | 4.0/5: 80% combo_points horrific_appendages
4:01.803 finish H envenom Fluffy_Pillow 35.6/170: 21% energy | 4.0/5: 80% combo_points horrific_appendages
4:02.808 Waiting     1.200 sec 32.4/170: 19% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
4:04.008 build D mutilate Fluffy_Pillow 56.6/170: 33% energy | 0.0/5: 0% combo_points envenom, horrific_appendages
4:05.011 Waiting     1.033 sec 23.4/170: 14% energy | 3.0/5: 60% combo_points envenom
4:06.044 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 3.0/5: 60% combo_points envenom
4:08.324 maintain L garrote Fluffy_Pillow 47.5/170: 28% energy | 5.0/5: 100% combo_points
4:09.331 Waiting     0.895 sec 14.4/170: 8% energy | 5.0/5: 100% combo_points
4:10.226 finish H envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points
4:11.230 Waiting     1.167 sec 21.8/170: 13% energy | 0.0/5: 0% combo_points envenom
4:12.397 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points envenom
4:13.401 Waiting     1.960 sec 12.5/170: 7% energy | 2.0/5: 40% combo_points envenom
4:15.361 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 2.0/5: 40% combo_points envenom
4:16.366 Waiting     0.300 sec 32.5/170: 19% energy | 4.0/5: 80% combo_points
4:16.666 finish H envenom Fluffy_Pillow 36.0/170: 21% energy | 4.0/5: 80% combo_points
4:17.670 Waiting     1.927 sec 12.9/170: 8% energy | 0.0/5: 0% combo_points envenom
4:19.597 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points envenom
4:20.602 Waiting     1.400 sec 32.5/170: 19% energy | 2.0/5: 40% combo_points envenom
4:22.002 build D mutilate Fluffy_Pillow 59.0/170: 35% energy | 2.0/5: 40% combo_points
4:23.008 cds G vanish Fluffy_Pillow 25.9/170: 15% energy | 5.0/5: 100% combo_points
4:23.018 maintain I rupture Fluffy_Pillow 26.0/170: 15% energy | 5.0/5: 100% combo_points vanish
4:24.022 Waiting     0.600 sec 32.9/170: 19% energy | 0.0/5: 0% combo_points
4:25.131 maintain L garrote Fluffy_Pillow 46.0/170: 27% energy | 0.0/5: 0% combo_points
4:26.135 Waiting     1.900 sec 32.8/170: 19% energy | 1.0/5: 20% combo_points
4:28.035 build D mutilate Fluffy_Pillow 75.2/170: 44% energy | 1.0/5: 20% combo_points
4:29.040 Waiting     0.300 sec 32.1/170: 19% energy | 4.0/5: 80% combo_points
4:29.340 finish H envenom Fluffy_Pillow 35.6/170: 21% energy | 4.0/5: 80% combo_points
4:30.345 Waiting     1.700 sec 32.5/170: 19% energy | 0.0/5: 0% combo_points envenom
4:32.045 build D mutilate Fluffy_Pillow 72.6/170: 43% energy | 0.0/5: 0% combo_points envenom
4:33.049 Waiting     1.000 sec 29.4/170: 17% energy | 3.0/5: 60% combo_points envenom
4:34.049 build D mutilate Fluffy_Pillow 61.2/170: 36% energy | 3.0/5: 60% combo_points envenom
4:35.050 cds F vendetta Fluffy_Pillow 18.1/170: 11% energy | 5.0/5: 100% combo_points
4:35.050 finish H envenom Fluffy_Pillow 170.0/170: 100% energy | 5.0/5: 100% combo_points
4:36.056 build D mutilate Fluffy_Pillow 166.9/170: 98% energy | 0.0/5: 0% combo_points envenom
4:37.061 build D mutilate Fluffy_Pillow 123.7/170: 73% energy | 3.0/5: 60% combo_points envenom
4:38.065 finish H envenom Fluffy_Pillow 100.6/170: 59% energy | 5.0/5: 100% combo_points envenom
4:39.070 maintain K kingsbane Fluffy_Pillow 77.5/170: 46% energy | 0.0/5: 0% combo_points envenom
4:40.089 build D mutilate Fluffy_Pillow 74.5/170: 44% energy | 1.0/5: 20% combo_points envenom
4:41.094 Waiting     0.400 sec 31.4/170: 18% energy | 4.0/5: 80% combo_points envenom
4:41.494 finish H envenom Fluffy_Pillow 36.1/170: 21% energy | 4.0/5: 80% combo_points envenom
4:42.498 Waiting     0.200 sec 32.9/170: 19% energy | 0.0/5: 0% combo_points envenom
4:43.721 maintain L garrote Fluffy_Pillow 47.4/170: 28% energy | 0.0/5: 0% combo_points envenom
4:44.726 Waiting     1.300 sec 34.2/170: 20% energy | 1.0/5: 20% combo_points envenom
4:46.026 build D mutilate Fluffy_Pillow 69.6/170: 41% energy | 1.0/5: 20% combo_points envenom
4:47.031 Waiting     1.000 sec 26.4/170: 16% energy | 4.0/5: 80% combo_points envenom
4:48.031 build D mutilate Fluffy_Pillow 58.3/170: 34% energy | 4.0/5: 80% combo_points
4:49.036 Waiting     0.937 sec 15.1/170: 9% energy | 5.0/5: 100% combo_points
4:49.973 maintain J rupture Fluffy_Pillow 26.2/170: 15% energy | 5.0/5: 100% combo_points
4:50.979 Waiting     1.100 sec 33.1/170: 19% energy | 0.0/5: 0% combo_points
4:52.079 build D mutilate Fluffy_Pillow 66.0/170: 39% energy | 0.0/5: 0% combo_points
4:53.082 Waiting     0.979 sec 22.9/170: 13% energy | 4.0/5: 80% combo_points
4:54.061 finish H envenom Fluffy_Pillow 54.4/170: 32% energy | 4.0/5: 80% combo_points
4:55.065 Waiting     1.000 sec 31.3/170: 18% energy | 0.0/5: 0% combo_points envenom
4:56.065 build D mutilate Fluffy_Pillow 63.1/170: 37% energy | 0.0/5: 0% combo_points envenom
4:57.070 Waiting     1.026 sec 20.0/170: 12% energy | 4.0/5: 80% combo_points envenom
4:58.096 finish H envenom Fluffy_Pillow 52.1/170: 31% energy | 4.0/5: 80% combo_points envenom
4:59.100 Waiting     1.000 sec 28.9/170: 17% energy | 0.0/5: 0% combo_points envenom
5:00.100 build D mutilate Fluffy_Pillow 60.7/170: 36% energy | 0.0/5: 0% combo_points envenom
5:01.104 Waiting     1.527 sec 17.6/170: 10% energy | 2.0/5: 40% combo_points envenom
5:02.631 build D mutilate Fluffy_Pillow 55.6/170: 33% energy | 2.0/5: 40% combo_points envenom

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 27135 25429 15189 (10649)
Stamina 44192 44192 26782
Intellect 5325 5000 0
Spirit 0 0 0
Health 2651520 2651520 0
Energy 170 170 0
Combo Points 5 5 0
Crit 32.25% 32.25% 8900
Haste 7.33% 7.33% 2747
Damage / Heal Versatility 4.34% 3.54% 1680
Attack Power 27135 25429 0
Mastery 132.24% 132.24% 10024
Armor 2244 2244 2244
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Hood of the Blind Executioner
ilevel: 870, stats: { 286 Armor, +2461 Sta, +1641 AgiInt, +991 Crit, +485 Mastery }
Local Neck Chain of the Underking
ilevel: 870, stats: { +1385 Sta, +1467 Crit, +978 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Spaulders of Aberrant Inhibition
ilevel: 865, stats: { 259 Armor, +1174 AgiInt, +1762 Sta, +777 Mastery, +311 Crit }
Local Chest Chestguard of Insidious Desire
ilevel: 880, stats: { 364 Armor, +2701 Sta, +1801 AgiInt, +931 Crit, +602 Mastery }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +2026 Sta, +1351 AgiInt, +673 Mastery, +476 Vers }
Local Legs Will of Valeera
ilevel: 910, stats: { 352 Armor, +3573 Sta, +2382 Agi, +612 Crit, +1103 Haste }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +2026 Sta, +1351 AgiInt, +673 Mastery, +476 Haste }, gems: { +150 Mastery }
Local Wrists Sky-Valiant's Wristguards
ilevel: 875, stats: { 156 Armor, +1450 Sta, +967 AgiInt, +568 Crit, +278 Vers }
Local Hands Biornskin Gloves
ilevel: 880, stats: { 227 Armor, +1351 AgiInt, +2027 Sta, +780 Crit, +369 Mastery }
Local Finger1 Insignia of Ravenholdt
ilevel: 910, stats: { +2010 Sta, +2004 Crit, +1114 Haste }, gems: { +200 Agi }, enchant: { +200 Mastery }
Local Finger2 Ring of Minute Mirrors
ilevel: 855, stats: { +1204 Sta, +1339 Mastery, +893 Vers }, enchant: { +200 Mastery }
Local Trinket1 Terrorbound Nexus
ilevel: 860, stats: { +1016 Mastery }
Local Trinket2 Spontaneous Appendages
ilevel: 865, stats: { +1036 Mastery }, gems: { +150 Mastery }
Local Back Drape of the Forgotten Souls
ilevel: 880, stats: { 145 Armor, +1013 StrAgiInt, +1519 Sta, +505 Mastery, +357 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +879 Agi, +1319 Sta, +352 Crit, +337 Mastery }, relics: { +49 ilevels, +46 ilevels, +49 ilevels }
Local Off Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +879 Agi, +1319 Sta, +352 Crit, +337 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Ptitfille"
origin="https://eu.api.battle.net/wow/character/hyjal/Ptitfille/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/206/115091406-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=800/herbalism=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ca!0022000
artifact=43:0:0:0:0:323:1:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1:1384:5
spec=assassination

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=call_action_list,name=cds
actions+=/call_action_list,name=maintain
# The 'active_dot.rupture>=spell_targets.rupture' means that we don't want to envenom as long as we can multi-rupture (i.e. units that don't have rupture yet).
actions+=/call_action_list,name=finish,if=(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)&(!dot.rupture.refreshable|(dot.rupture.exsanguinated&dot.rupture.remains>=3.5)|target.time_to_die-dot.rupture.remains<=4)&active_dot.rupture>=spell_targets.rupture
actions+=/call_action_list,name=build,if=(combo_points.deficit>0|energy.time_to_max<1)

# Builders
actions.build=hemorrhage,if=refreshable
actions.build+=/hemorrhage,cycle_targets=1,if=refreshable&dot.rupture.ticking&spell_targets.fan_of_knives<=3
actions.build+=/fan_of_knives,if=spell_targets>=3|buff.the_dreadlords_deceit.stack>=29
actions.build+=/mutilate,cycle_targets=1,if=(!talent.agonizing_poison.enabled&dot.deadly_poison_dot.refreshable)|(talent.agonizing_poison.enabled&debuff.agonizing_poison.remains<debuff.agonizing_poison.duration*0.3)|(set_bonus.tier19_2pc=1&dot.mutilated_flesh.refreshable)
actions.build+=/mutilate

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions.cds+=/blood_fury,if=debuff.vendetta.up
actions.cds+=/berserking,if=debuff.vendetta.up
actions.cds+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<5&dot.rupture.ticking
actions.cds+=/vendetta,if=talent.exsanguinate.enabled&(artifact.master_assassin.rank>=4-equipped.convergence_of_fates|equipped.duskwalkers_footpads)&energy.deficit>=75&!(artifact.master_assassin.rank=5-equipped.convergence_of_fates&equipped.duskwalkers_footpads)
actions.cds+=/vendetta,if=!talent.exsanguinate.enabled&energy.deficit>=88-!talent.venom_rush.enabled*10
actions.cds+=/vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&((talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&(dot.rupture.ticking|time>10))|(!talent.exsanguinate.enabled&dot.rupture.refreshable))
actions.cds+=/vanish,if=talent.subterfuge.enabled&dot.garrote.refreshable&((spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives)|(spell_targets.fan_of_knives>=4&combo_points.deficit>=4))
actions.cds+=/vanish,if=talent.shadow_focus.enabled&energy.time_to_max>=2&combo_points.deficit>=4
actions.cds+=/exsanguinate,if=prev_gcd.1.rupture&dot.rupture.remains>4+4*cp_max_spend

# Finishers
actions.finish=death_from_above,if=combo_points>=cp_max_spend
actions.finish+=/envenom,if=combo_points>=4|(talent.elaborate_planning.enabled&combo_points>=3+!talent.exsanguinate.enabled&buff.elaborate_planning.remains<0.1)

# Maintain
actions.maintain=rupture,if=(talent.nightstalker.enabled&stealthed.rogue)|(talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2+artifact.urge_to_kill.enabled))))
actions.maintain+=/rupture,cycle_targets=1,if=combo_points>=cp_max_spend-talent.exsanguinate.enabled&refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4
actions.maintain+=/kingsbane,if=(talent.exsanguinate.enabled&dot.rupture.exsanguinated)|(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))
actions.maintain+=/pool_resource,for_next=1
actions.maintain+=/garrote,cycle_targets=1,if=refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727/1522/3337
neck=chain_of_the_underking,id=134495,bonus_id=3415/1522/3337,enchant=mark_of_the_hidden_satyr
shoulders=spaulders_of_aberrant_inhibition,id=134453,bonus_id=3418/1517/1813
back=drape_of_the_forgotten_souls,id=142541,bonus_id=3468/1497/3336,enchant=200agi
chest=chestguard_of_insidious_desire,id=137514,bonus_id=3418/1532/3337
wrists=skyvaliants_wristguards,id=142419,bonus_id=3468/1492
hands=biornskin_gloves,id=134195,bonus_id=3509/1542/3336
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806/1502
legs=will_of_valeera,id=137069,bonus_id=1811
feet=stained_maggot_squishers,id=139200,bonus_id=1806/1808/1502,gems=150mastery
finger1=insignia_of_ravenholdt,id=137049,bonus_id=3459/3458,gems=200agi,enchant=200mastery
finger2=ring_of_minute_mirrors,id=137533,bonus_id=3413/1507/3336,enchant=200mastery
trinket1=terrorbound_nexus,id=137406,bonus_id=3417/1808/1512/1813
trinket2=spontaneous_appendages,id=139325,bonus_id=1805/1808/1487,gems=150mastery
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=140821/142306/140818/0,relic_id=3443:1467:1813/3453:1472/3443:1467:1813/0
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=879.25
# gear_agility=15189
# gear_stamina=26782
# gear_crit_rating=8725
# gear_haste_rating=2693
# gear_mastery_rating=9827
# gear_versatility_rating=1647
# gear_armor=2244

Splouch

Splouch : 424340 dps

  • Race: Night Elf
  • Class: Rogue
  • Spec: Assassination
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
424340.0 424340.0 306.9 / 0.072% 61639.1 / 14.5% 17647.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
24.0 24.0 Energy 42.35% 33.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Splouch/advanced
Talents
  • 15: Master Poisoner (Assassination Rogue)
  • 30: Nightstalker
  • 45: Vigor
  • 60: Cheat Death
  • 75: Thuggee (Assassination Rogue)
  • 90: Agonizing Poison (Assassination Rogue)
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • skinning: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Splouch 424340
auto_attack_mh 18294 4.3% 186.2 1.62sec 29526 18479 Direct 186.2 25216 50481 29527 36.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 186.25 186.25 0.00 0.00 1.5979 0.0000 5499152.88 8084275.62 31.98 18478.58 18478.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.87 45.03% 25216.06 16825 30801 25216.96 24184 26377 2114906 3109112 31.98
crit 67.04 36.00% 50480.51 33651 61602 50483.34 48051 52924 3384247 4975164 31.98
miss 35.33 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9045 2.1% 183.8 1.64sec 14791 9151 Direct 183.8 12627 25270 14792 36.1% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.82 183.82 0.00 0.00 1.6164 0.0000 2718908.08 3997052.41 31.98 9150.51 9150.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.62 44.95% 12626.88 8413 15401 12627.52 12105 13150 1043265 1533698 31.98
crit 66.31 36.07% 25270.16 16825 30801 25272.28 23768 26729 1675643 2463354 31.98
miss 34.89 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Envenom 59827 14.1% 36.6 8.17sec 491864 489669 Direct 36.6 361025 722385 491867 36.2% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.56 36.56 0.00 0.00 1.0045 0.0000 17982616.62 17982616.62 0.00 489669.33 489669.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.32 63.79% 361024.53 204714 468442 361207.85 323384 418134 8419819 8419819 0.00
crit 13.24 36.21% 722385.24 532257 936884 722773.68 612026 868574 9562797 9562797 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Fan of Knives 11020 2.6% 5.7 58.48sec 586447 583852 Direct 5.6 430331 866525 586995 35.9% 0.0%  

Stats details: fan_of_knives

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.65 5.65 0.00 0.00 1.0045 0.0000 3316280.67 4875246.72 31.98 583852.23 583852.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.62 64.09% 430330.51 320925 587491 427678.37 0 587491 1558072 2290513 31.87
crit 2.03 35.91% 866524.94 641850 1174983 792398.51 0 1174983 1758209 2584734 29.28
 
 

Action details: fan_of_knives

Static Values
  • id:51723
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets>=3|buff.the_dreadlords_deceit.stack>=29
Spelldata
  • id:51723
  • name:Fan of Knives
  • school:physical
  • tooltip:
  • description:Sprays knives at all targets within $A1 yards, dealing {$s1=1} Physical damage and applying your active poisons at their normal rate. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.079000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
From the Shadows 11430 2.7% 144.7 3.67sec 23728 0 Direct 144.7 17440 34885 23728 36.0% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.69 144.69 0.00 0.00 0.0000 0.0000 3433247.16 3433247.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.54 63.96% 17440.49 12450 26297 17439.72 16919 17587 1613972 1613972 0.00
crit 52.15 36.04% 34885.05 24899 52448 34883.23 33470 35393 1819275 1819275 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 35743 8.4% 17.0 17.90sec 632436 629624 Periodic 149.8 52704 105446 71748 36.1% 0.0% 99.6%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.99 0.00 149.79 149.79 1.0045 2.0000 10747048.49 10747048.49 0.00 33940.05 629623.79
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.7 63.89% 52704.28 34220 93965 52731.41 50030 55667 5044007 5044007 0.00
crit 54.1 36.11% 105446.44 68439 187929 105502.55 98468 115596 5703042 5703042 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Horrific Slam 9674 2.3% 64.2 3.15sec 45324 0 Direct 64.2 33300 66627 45324 36.1% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.21 64.21 0.00 0.00 0.0000 0.0000 2910124.66 2910124.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.04 63.92% 33300.27 23813 33533 33306.34 30389 33533 1366745 1366745 0.00
crit 23.16 36.08% 66626.61 47626 67065 66632.33 60030 67065 1543380 1543380 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17354.25
  • base_dd_max:19181.01
 
Insignia of Ravenholdt 18540 4.4% 160.6 3.74sec 34697 0 Direct 160.6 25498 51027 34698 36.0% 0.0%  

Stats details: insignia_of_ravenholdt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 160.64 160.64 0.00 0.00 0.0000 0.0000 5573819.87 5573819.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.76 63.97% 25498.49 11163 40874 25500.92 23142 27732 2620078 2620078 0.00
crit 57.88 36.03% 51027.42 22327 81747 51024.66 43187 58258 2953742 2953742 0.00
 
 

Action details: insignia_of_ravenholdt

Static Values
  • id:209043
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209043
  • name:Insignia of Ravenholdt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209041=Your attacks that generate combo points deal {$s1=15}% additional damage as Shadow to all targets within $209043A1 yards in front of you.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:64518.11
  • base_dd_max:64518.11
 
Kingsbane 32195 (46419) 7.6% (10.9%) 7.0 45.37sec 1984457 1975603 Periodic 48.0 148313 296577 201767 36.1% 0.0% 31.9%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 0.00 47.97 47.97 1.0045 2.0000 9677844.36 9677844.36 0.00 135423.02 1975603.18
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.7 63.95% 148312.99 53847 406007 148225.29 114479 191200 4549081 4549081 0.00
crit 17.3 36.05% 296576.56 107693 795050 296431.45 173132 416658 5128764 5128764 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.exsanguinate.enabled&dot.rupture.exsanguinated)|(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 9483 2.2% 7.0 45.37sec 404985 0 Direct 7.0 297517 594947 405010 36.1% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 2846436.12 2846436.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.49 63.87% 297517.34 224208 347295 297021.84 0 347295 1335497 1335497 0.00
crit 2.54 36.13% 594947.39 448416 694589 567074.14 0 694589 1510940 1510940 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 4741 1.1% 7.0 45.37sec 202529 0 Direct 7.0 149025 298209 202525 35.9% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 1423477.94 1423477.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.51 64.13% 149024.99 112104 173647 148742.54 0 173647 671746 671746 0.00
crit 2.52 35.87% 298209.47 224208 347295 283641.95 0 347295 751732 751732 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mutilate 0 (61980) 0.0% (14.6%) 80.3 3.74sec 231977 230940

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.32 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 230940.27 230940.27
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.agonizing_poison.enabled&dot.deadly_poison_dot.refreshable)|(talent.agonizing_poison.enabled&debuff.agonizing_poison.remains<debuff.agonizing_poison.duration*0.3)|(set_bonus.tier19_2pc=1&dot.mutilated_flesh.refreshable)
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 41307 9.7% 80.3 3.74sec 154600 0 Direct 80.3 108820 217746 154601 42.0% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.32 80.32 0.00 0.00 0.0000 0.0000 12417492.87 18254890.74 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.56 57.97% 108820.34 71478 130849 108827.83 102364 115911 5066909 7448836 31.98
crit 33.76 42.03% 217745.58 142957 261699 217772.04 201924 235332 7350584 10806054 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 20673 4.9% 80.3 3.74sec 77378 0 Direct 80.3 54443 108917 77377 42.1% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.32 80.32 0.00 0.00 0.0000 0.0000 6214998.87 9136637.04 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.50 57.90% 54443.43 35737 65421 54444.21 51602 58429 2531806 3721995 31.98
crit 33.82 42.10% 108917.44 71474 130842 108934.89 101704 116624 3683193 5414642 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 31752 7.5% 37.8 6.01sec 252772 0 Direct 37.8 185532 371052 252772 36.2% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.76 37.76 0.00 0.00 0.0000 0.0000 9545487.36 9545487.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.08 63.76% 185532.30 130392 187014 185547.34 171464 187014 4466922 4466922 0.00
crit 13.69 36.24% 371051.85 260784 374028 371080.76 334585 374028 5078565 5078565 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 21216 4.9% 22.6 5.62sec 278007 0 Direct 22.6 204629 410316 278001 35.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.57 22.57 0.00 0.00 0.0000 0.0000 6275964.65 9226262.51 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.52 64.33% 204628.72 150650 212141 204583.81 181322 212141 2971473 4368347 31.98
crit 8.05 35.67% 410316.46 301300 424281 410227.60 0 424281 3304492 4857916 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 89402 21.1% 12.7 23.77sec 2113737 2104391 Periodic 147.8 122115 243966 182022 49.2% 0.0% 98.3%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 147.80 147.80 1.0045 2.0000 26902528.93 26902528.93 0.00 87238.81 2104390.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.1 50.84% 122114.91 64444 353919 122091.40 100361 161975 9175192 9175192 0.00
crit 72.7 49.16% 243966.37 128889 707838 243977.22 198208 315188 17727337 17727337 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.nightstalker.enabled&stealthed.rogue)|(talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2+artifact.urge_to_kill.enabled))))
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*8/2} over 8 sec 2 points: ${{$s1=0}*12/2} over 12 sec 3 points: ${{$s1=0}*16/2} over 16 sec 4 points: ${{$s1=0}*20/2} over 20 sec 5 points: ${{$s1=0}*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Splouch
Agonizing Poison 251.6 1.31sec

Stats details: agonizing_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 251.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: agonizing_poison

Static Values
  • id:200803
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200803
  • name:Agonizing Poison
  • school:nature
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${{$200803s1=4}}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Splouch
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Splouch
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Splouch
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.7 133.55sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.nightstalker.enabled&combo_points>=cp_max_spend&((talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&(dot.rupture.ticking|time>10))|(!talent.exsanguinate.enabled&dot.rupture.refreshable))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.7 90.12sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.exsanguinate.enabled&cooldown.exsanguinate.remains<5&dot.rupture.ticking
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 24.15% 0.0(0.0) 1.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Envenom 25.6 11.0 11.7sec 8.2sec 65.07% 61.89% 11.0(11.0) 24.8

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:65.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 3.7 0.6 69.1sec 56.2sec 16.21% 16.21% 64.8(64.8) 3.5

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Legion's Gaze 1.0 298.8 0.0sec 1.0sec 99.95% 99.95% 289.8(289.8) 0.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_legions_gaze
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:148.15

Stack Uptimes

  • legions_gaze_1:0.27%
  • legions_gaze_2:0.27%
  • legions_gaze_3:0.26%
  • legions_gaze_4:0.24%
  • legions_gaze_5:0.24%
  • legions_gaze_6:0.26%
  • legions_gaze_7:0.26%
  • legions_gaze_8:0.27%
  • legions_gaze_9:0.27%
  • legions_gaze_10:97.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:230152
  • name:Legion's Gaze
  • tooltip:Critical Strike increased by $w1. This effect is reset if you auto attack a different target.
  • description:{$@spelldesc230150=Your melee auto attacks increase your Critical Strike by {$230152s1=124} for {$230152d=10 seconds}, stacking up to {$230152u=10} times. This effect is reset if you auto attack a different target.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 94.5sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=75}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
The Dreadlord's Deceit 6.6 144.3 48.6sec 2.0sec 97.38% 100.00% 0.3(0.3) 0.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_the_dreadlords_deceit
  • max_stacks:30
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35

Stack Uptimes

  • the_dreadlords_deceit_1:3.74%
  • the_dreadlords_deceit_2:3.71%
  • the_dreadlords_deceit_3:3.68%
  • the_dreadlords_deceit_4:3.65%
  • the_dreadlords_deceit_5:3.62%
  • the_dreadlords_deceit_6:3.59%
  • the_dreadlords_deceit_7:3.56%
  • the_dreadlords_deceit_8:3.54%
  • the_dreadlords_deceit_9:3.51%
  • the_dreadlords_deceit_10:3.48%
  • the_dreadlords_deceit_11:3.46%
  • the_dreadlords_deceit_12:3.44%
  • the_dreadlords_deceit_13:3.42%
  • the_dreadlords_deceit_14:3.40%
  • the_dreadlords_deceit_15:3.38%
  • the_dreadlords_deceit_16:3.36%
  • the_dreadlords_deceit_17:3.34%
  • the_dreadlords_deceit_18:3.32%
  • the_dreadlords_deceit_19:3.30%
  • the_dreadlords_deceit_20:3.28%
  • the_dreadlords_deceit_21:3.26%
  • the_dreadlords_deceit_22:3.24%
  • the_dreadlords_deceit_23:3.22%
  • the_dreadlords_deceit_24:3.20%
  • the_dreadlords_deceit_25:3.18%
  • the_dreadlords_deceit_26:3.16%
  • the_dreadlords_deceit_27:3.14%
  • the_dreadlords_deceit_28:3.12%
  • the_dreadlords_deceit_29:1.36%
  • the_dreadlords_deceit_30:0.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208693
  • name:The Dreadlord's Deceit
  • tooltip:Your next Fan of Knives deals {$s1=35}% increased damage.
  • description:{$@spelldesc208692=Every $t1 sec, gain {$?s137035=false}[$228224S1%][{$208693s1=35}%] increased damage for your next {$?s137035=false}[Shuriken Storm][Fan of Knives], stacking up to {$208693u=30} times.}
  • max_stacks:30
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.7 0.0 133.8sec 133.8sec 0.14% 0.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Seal Fate 72.1 5.2sec

Resources

Resource Usage Type Count Total Average RPE APR
Splouch
envenom Energy 36.6 1279.6 35.0 35.0 14053.2
envenom Combo Points 36.6 168.8 4.6 4.6 106551.1
fan_of_knives Energy 5.7 197.9 35.0 35.0 16754.8
garrote Energy 17.0 764.7 45.0 45.0 14054.1
kingsbane Energy 7.0 246.0 35.0 35.0 56698.9
mutilate Energy 80.3 4417.6 55.0 55.0 4217.8
rupture Energy 12.7 318.2 25.0 25.0 84548.7
rupture Combo Points 12.7 63.6 5.0 5.0 422743.5
Resource Gains Type Count Total Average Overflow
fan_of_knives Combo Points 5.66 5.66 (2.41%) 1.00 0.00 0.00%
mutilate Combo Points 80.32 157.73 (67.19%) 1.96 2.91 1.81%
kingsbane Combo Points 7.03 5.93 (2.52%) 0.84 1.10 15.67%
garrote Combo Points 16.99 14.69 (6.26%) 0.86 2.30 13.55%
energy_regen Energy 1849.94 3646.88 (51.48%) 1.97 0.30 0.01%
seal_fate Combo Points 72.13 50.76 (21.62%) 0.70 21.37 29.63%
Venomous Vim Energy 297.30 2972.98 (41.97%) 10.00 0.06 0.00%
Urge to Kill Energy 3.73 464.06 (6.55%) 124.38 170.20 26.83%
Resource RPS-Gain RPS-Loss
Energy 23.55 24.01
Combo Points 0.78 0.77
Combat End Resource Mean Min Max
Energy 30.44 0.05 156.04
Combo Points 2.34 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data Splouch Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Splouch Damage Per Second
Count 9999
Mean 424340.02
Minimum 377002.34
Maximum 499838.92
Spread ( max - min ) 122836.58
Range [ ( max - min ) / 2 * 100% ] 14.47%
Standard Deviation 15659.6957
5th Percentile 400054.25
95th Percentile 451371.64
( 95th Percentile - 5th Percentile ) 51317.39
Mean Distribution
Standard Deviation 156.6048
95.00% Confidence Intervall ( 424033.08 - 424646.96 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5232
0.1 Scale Factor Error with Delta=300 2093391
0.05 Scale Factor Error with Delta=300 8373564
0.01 Scale Factor Error with Delta=300 209339079
Priority Target DPS
Sample Data Splouch Priority Target Damage Per Second
Count 9999
Mean 424340.02
Minimum 377002.34
Maximum 499838.92
Spread ( max - min ) 122836.58
Range [ ( max - min ) / 2 * 100% ] 14.47%
Standard Deviation 15659.6957
5th Percentile 400054.25
95th Percentile 451371.64
( 95th Percentile - 5th Percentile ) 51317.39
Mean Distribution
Standard Deviation 156.6048
95.00% Confidence Intervall ( 424033.08 - 424646.96 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5232
0.1 Scale Factor Error with Delta=300 2093391
0.05 Scale Factor Error with Delta=300 8373564
0.01 Scale Factor Error with Delta=300 209339079
DPS(e)
Sample Data Splouch Damage Per Second (Effective)
Count 9999
Mean 424340.02
Minimum 377002.34
Maximum 499838.92
Spread ( max - min ) 122836.58
Range [ ( max - min ) / 2 * 100% ] 14.47%
Damage
Sample Data Splouch Damage
Count 9999
Mean 127485429.54
Minimum 93633371.34
Maximum 165651167.43
Spread ( max - min ) 72017796.09
Range [ ( max - min ) / 2 * 100% ] 28.25%
DTPS
Sample Data Splouch Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Splouch Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Splouch Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Splouch Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Splouch Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Splouch Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SplouchTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Splouch Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=cds
9 0.00 call_action_list,name=maintain
A 0.00 call_action_list,name=finish,if=(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)&(!dot.rupture.refreshable|(dot.rupture.exsanguinated&dot.rupture.remains>=3.5)|target.time_to_die-dot.rupture.remains<=4)&active_dot.rupture>=spell_targets.rupture
The 'active_dot.rupture>=spell_targets.rupture' means that we don't want to envenom as long as we can multi-rupture (i.e. units that don't have rupture yet).
B 0.00 call_action_list,name=build,if=(combo_points.deficit>0|energy.time_to_max<1)
actions.build Builders
# count action,conditions
0.00 hemorrhage,if=refreshable
0.00 hemorrhage,cycle_targets=1,if=refreshable&dot.rupture.ticking&spell_targets.fan_of_knives<=3
C 5.66 fan_of_knives,if=spell_targets>=3|buff.the_dreadlords_deceit.stack>=29
D 0.24 mutilate,cycle_targets=1,if=(!talent.agonizing_poison.enabled&dot.deadly_poison_dot.refreshable)|(talent.agonizing_poison.enabled&debuff.agonizing_poison.remains<debuff.agonizing_poison.duration*0.3)|(set_bonus.tier19_2pc=1&dot.mutilated_flesh.refreshable)
E 80.08 mutilate
actions.cds Cooldowns
# count action,conditions
F 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
0.00 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
0.00 vendetta,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<5&dot.rupture.ticking
0.00 vendetta,if=talent.exsanguinate.enabled&(artifact.master_assassin.rank>=4-equipped.convergence_of_fates|equipped.duskwalkers_footpads)&energy.deficit>=75&!(artifact.master_assassin.rank=5-equipped.convergence_of_fates&equipped.duskwalkers_footpads)
G 3.73 vendetta,if=!talent.exsanguinate.enabled&energy.deficit>=88-!talent.venom_rush.enabled*10
H 2.72 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&((talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&(dot.rupture.ticking|time>10))|(!talent.exsanguinate.enabled&dot.rupture.refreshable))
0.00 vanish,if=talent.subterfuge.enabled&dot.garrote.refreshable&((spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives)|(spell_targets.fan_of_knives>=4&combo_points.deficit>=4))
0.00 vanish,if=talent.shadow_focus.enabled&energy.time_to_max>=2&combo_points.deficit>=4
0.00 exsanguinate,if=prev_gcd.1.rupture&dot.rupture.remains>4+4*cp_max_spend
actions.finish Finishers
# count action,conditions
0.00 death_from_above,if=combo_points>=cp_max_spend
I 36.56 envenom,if=combo_points>=4|(talent.elaborate_planning.enabled&combo_points>=3+!talent.exsanguinate.enabled&buff.elaborate_planning.remains<0.1)
actions.maintain Maintain
# count action,conditions
J 2.68 rupture,if=(talent.nightstalker.enabled&stealthed.rogue)|(talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2+artifact.urge_to_kill.enabled))))
K 10.05 rupture,cycle_targets=1,if=combo_points>=cp_max_spend-talent.exsanguinate.enabled&refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4
L 7.03 kingsbane,if=(talent.exsanguinate.enabled&dot.rupture.exsanguinated)|(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))
0.00 pool_resource,for_next=1
M 16.99 garrote,cycle_targets=1,if=refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4

Sample Sequence

012456MCDGLHJEEIEEIEMEIEEKEEIMEEIEEIELMKEEICEIEMEKEEIEIEMIEGFLEKEIEEIMEEIEEICMEHJEEIEELMKEEIEEIEMIEIEEEKMCEIGLEIEEIEEKMEIEEIEMEKEEIEELMICEIEEHJEMIEEIEEKMEIEGLIEIEEIEMEKECIEEIE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Splouch 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation Splouch 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food Splouch 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 apply_poison Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 potion Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, potion_of_the_old_war
0:00.000 maintain M garrote Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, potion_of_the_old_war
0:01.005 build C fan_of_knives Fluffy_Pillow 140.2/170: 82% energy | 1.0/5: 20% combo_points bloodlust, legions_gaze(2), potion_of_the_old_war
0:02.010 build D mutilate Fluffy_Pillow 120.5/170: 71% energy | 2.0/5: 40% combo_points bloodlust, the_dreadlords_deceit, legions_gaze(3), potion_of_the_old_war
0:03.015 cds G vendetta Fluffy_Pillow 80.7/170: 47% energy | 4.0/5: 80% combo_points bloodlust, the_dreadlords_deceit, legions_gaze(4), potion_of_the_old_war
0:03.015 maintain L kingsbane Fluffy_Pillow 170.0/170: 100% energy | 4.0/5: 80% combo_points bloodlust, the_dreadlords_deceit, legions_gaze(4), potion_of_the_old_war
0:04.019 cds H vanish Fluffy_Pillow 160.2/170: 94% energy | 5.0/5: 100% combo_points bloodlust, the_dreadlords_deceit(2), legions_gaze(6), potion_of_the_old_war
0:04.019 maintain J rupture Fluffy_Pillow 160.2/170: 94% energy | 5.0/5: 100% combo_points bloodlust, vanish, the_dreadlords_deceit(2), legions_gaze(6), potion_of_the_old_war
0:05.024 build E mutilate Fluffy_Pillow 150.5/170: 89% energy | 0.0/5: 0% combo_points bloodlust, the_dreadlords_deceit(2), legions_gaze(8), potion_of_the_old_war
0:06.029 build E mutilate Fluffy_Pillow 130.7/170: 77% energy | 3.0/5: 60% combo_points bloodlust, the_dreadlords_deceit(3), legions_gaze(10), potion_of_the_old_war
0:07.032 finish I envenom Fluffy_Pillow 90.9/170: 53% energy | 5.0/5: 100% combo_points bloodlust, the_dreadlords_deceit(3), legions_gaze(10), potion_of_the_old_war
0:08.038 build E mutilate Fluffy_Pillow 91.2/170: 54% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(4), legions_gaze(10), potion_of_the_old_war
0:09.044 Waiting     0.300 sec 51.4/170: 30% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(4), legions_gaze(10), potion_of_the_old_war
0:09.344 build E mutilate Fluffy_Pillow 56.0/170: 33% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(4), legions_gaze(10), potion_of_the_old_war
0:10.349 finish I envenom Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points bloodlust, envenom, the_dreadlords_deceit(5), legions_gaze(10), potion_of_the_old_war
0:11.354 Waiting     1.261 sec 16.5/170: 10% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(5), legions_gaze(10), potion_of_the_old_war
0:12.615 build E mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(6), legions_gaze(10), potion_of_the_old_war
0:13.618 Waiting     1.204 sec 15.8/170: 9% energy | 2.0/5: 40% combo_points bloodlust, envenom, the_dreadlords_deceit(6), legions_gaze(10), potion_of_the_old_war
0:14.822 maintain M garrote Fluffy_Pillow 54.1/170: 32% energy | 2.0/5: 40% combo_points bloodlust, envenom, the_dreadlords_deceit(7), legions_gaze(10), potion_of_the_old_war
0:16.006 Waiting     0.600 sec 37.0/170: 22% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(8), legions_gaze(10), potion_of_the_old_war
0:16.606 build E mutilate Fluffy_Pillow 56.1/170: 33% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(8), legions_gaze(10), potion_of_the_old_war
0:17.612 Waiting     0.566 sec 16.4/170: 10% energy | 5.0/5: 100% combo_points bloodlust, envenom, the_dreadlords_deceit(8), legions_gaze(10), potion_of_the_old_war
0:18.178 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points bloodlust, the_dreadlords_deceit(9), legions_gaze(10), potion_of_the_old_war
0:19.183 Waiting     0.900 sec 25.2/170: 15% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(9), legions_gaze(10), potion_of_the_old_war
0:20.083 build E mutilate Fluffy_Pillow 58.9/170: 35% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(10), legions_gaze(10), potion_of_the_old_war
0:21.088 Waiting     1.087 sec 19.1/170: 11% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(10), legions_gaze(10), potion_of_the_old_war
0:22.175 build E mutilate Fluffy_Pillow 55.6/170: 33% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(11), legions_gaze(10), potion_of_the_old_war
0:23.178 Waiting     0.704 sec 15.8/170: 9% energy | 5.0/5: 100% combo_points bloodlust, envenom, the_dreadlords_deceit(11), legions_gaze(10)
0:23.882 maintain K rupture Fluffy_Pillow 26.5/170: 16% energy | 5.0/5: 100% combo_points bloodlust, envenom, the_dreadlords_deceit(11), legions_gaze(10)
0:24.886 Waiting     1.200 sec 36.7/170: 22% energy | 0.0/5: 0% combo_points bloodlust, the_dreadlords_deceit(12), legions_gaze(10)
0:26.086 build E mutilate Fluffy_Pillow 74.9/170: 44% energy | 0.0/5: 0% combo_points bloodlust, the_dreadlords_deceit(13), legions_gaze(10)
0:27.090 Waiting     1.000 sec 35.2/170: 21% energy | 3.0/5: 60% combo_points bloodlust, the_dreadlords_deceit(13), legions_gaze(10)
0:28.090 build E mutilate Fluffy_Pillow 70.3/170: 41% energy | 3.0/5: 60% combo_points bloodlust, the_dreadlords_deceit(14), legions_gaze(10)
0:29.092 Waiting     0.300 sec 30.5/170: 18% energy | 5.0/5: 100% combo_points bloodlust, the_dreadlords_deceit(14), legions_gaze(10)
0:29.392 finish I envenom Fluffy_Pillow 35.1/170: 21% energy | 5.0/5: 100% combo_points bloodlust, the_dreadlords_deceit(14), legions_gaze(10)
0:30.398 Waiting     0.300 sec 35.3/170: 21% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(15), legions_gaze(10)
0:31.207 maintain M garrote Fluffy_Pillow 47.6/170: 28% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(15), legions_gaze(10)
0:32.212 Waiting     1.200 sec 37.9/170: 22% energy | 1.0/5: 20% combo_points bloodlust, envenom, the_dreadlords_deceit(16), legions_gaze(10)
0:33.412 build E mutilate Fluffy_Pillow 56.1/170: 33% energy | 1.0/5: 20% combo_points bloodlust, envenom, the_dreadlords_deceit(16), legions_gaze(10)
0:34.416 Waiting     1.300 sec 36.3/170: 21% energy | 3.0/5: 60% combo_points bloodlust, envenom, the_dreadlords_deceit(17), legions_gaze(10)
0:35.716 build E mutilate Fluffy_Pillow 56.0/170: 33% energy | 3.0/5: 60% combo_points bloodlust, the_dreadlords_deceit(17), legions_gaze(10)
0:36.720 finish I envenom Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points bloodlust, the_dreadlords_deceit(18), legions_gaze(10)
0:37.725 Waiting     1.261 sec 16.5/170: 10% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(18), legions_gaze(10)
0:38.986 build E mutilate Fluffy_Pillow 55.6/170: 33% energy | 0.0/5: 0% combo_points bloodlust, envenom, the_dreadlords_deceit(19), legions_gaze(10)
0:39.991 Waiting     1.703 sec 15.8/170: 9% energy | 2.0/5: 40% combo_points bloodlust, envenom, the_dreadlords_deceit(19), legions_gaze(10)
0:41.694 build E mutilate Fluffy_Pillow 55.7/170: 33% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10)
0:42.699 Waiting     0.300 sec 32.4/170: 19% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10)
0:42.999 finish I envenom Fluffy_Pillow 35.9/170: 21% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(21), legions_gaze(10)
0:44.002 Waiting     2.001 sec 22.6/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10)
0:46.003 build E mutilate Fluffy_Pillow 66.0/170: 39% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
0:47.010 Waiting     0.800 sec 32.7/170: 19% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
0:47.810 maintain L kingsbane Fluffy_Pillow 42.1/170: 25% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
0:49.528 maintain M garrote Fluffy_Pillow 47.1/170: 28% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(24), legions_gaze(10)
0:50.534 maintain K rupture Fluffy_Pillow 33.9/170: 20% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(25), legions_gaze(10)
0:51.538 Waiting     1.279 sec 20.6/170: 12% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(25), legions_gaze(10)
0:52.817 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(26), legions_gaze(10)
0:53.822 Waiting     1.995 sec 12.2/170: 7% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(26), legions_gaze(10)
0:55.817 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(27), legions_gaze(10)
0:56.821 Waiting     0.300 sec 32.2/170: 19% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(28), legions_gaze(10)
0:57.121 finish I envenom Fluffy_Pillow 35.7/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(28), legions_gaze(10)
0:58.127 Waiting     0.300 sec 32.5/170: 19% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(29), legions_gaze(10)
0:58.427 build C fan_of_knives Fluffy_Pillow 36.0/170: 21% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(29), legions_gaze(10)
0:59.433 Waiting     1.954 sec 12.7/170: 7% energy | 2.0/5: 40% combo_points envenom, legions_gaze(10)
1:01.387 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit, legions_gaze(10)
1:02.392 Waiting     0.300 sec 32.2/170: 19% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(2), legions_gaze(10)
1:02.692 finish I envenom Fluffy_Pillow 35.7/170: 21% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(2), legions_gaze(10)
1:03.699 Waiting     1.974 sec 12.5/170: 7% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(2), legions_gaze(10)
1:05.673 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(3), legions_gaze(10)
1:07.954 maintain M garrote Fluffy_Pillow 47.1/170: 28% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(4), legions_gaze(10)
1:08.957 Waiting     1.100 sec 33.8/170: 20% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(5), legions_gaze(10)
1:10.057 build E mutilate Fluffy_Pillow 66.6/170: 39% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(6), legions_gaze(10)
1:11.061 Waiting     0.240 sec 23.4/170: 14% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(6), legions_gaze(10)
1:11.301 maintain K rupture Fluffy_Pillow 26.2/170: 15% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(6), legions_gaze(10)
1:12.306 Waiting     1.700 sec 32.9/170: 19% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(7), legions_gaze(10)
1:14.006 build E mutilate Fluffy_Pillow 62.7/170: 37% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(8), legions_gaze(10)
1:15.009 Waiting     1.100 sec 29.4/170: 17% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(8), legions_gaze(10)
1:16.109 build E mutilate Fluffy_Pillow 62.3/170: 37% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(9), legions_gaze(10)
1:17.113 Waiting     0.916 sec 19.0/170: 11% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(9), legions_gaze(10)
1:18.029 finish I envenom Fluffy_Pillow 49.7/170: 29% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(10), legions_gaze(10)
1:19.033 Waiting     1.000 sec 26.4/170: 16% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(10), legions_gaze(10)
1:20.033 build E mutilate Fluffy_Pillow 58.0/170: 34% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(11), legions_gaze(10)
1:21.040 Waiting     0.974 sec 14.8/170: 9% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(11), legions_gaze(10)
1:22.014 finish I envenom Fluffy_Pillow 36.2/170: 21% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(12), legions_gaze(10)
1:23.018 Waiting     1.082 sec 22.9/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(12), legions_gaze(10)
1:24.100 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(13), legions_gaze(10)
1:26.383 maintain M garrote Fluffy_Pillow 47.1/170: 28% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(14), legions_gaze(10)
1:27.390 Waiting     0.952 sec 13.9/170: 8% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(14), legions_gaze(10)
1:28.342 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(15), legions_gaze(10)
1:29.346 Waiting     1.182 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(15), legions_gaze(10)
1:30.528 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(16), legions_gaze(10)
1:31.534 Waiting     1.294 sec 12.2/170: 7% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(16), legions_gaze(10)
1:32.828 cds G vendetta Fluffy_Pillow 47.3/170: 28% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10)
1:33.015 cds F potion Fluffy_Pillow 170.0/170: 100% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10)
1:33.015 maintain L kingsbane Fluffy_Pillow 170.0/170: 100% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10), potion_of_the_old_war
1:34.020 build E mutilate Fluffy_Pillow 166.7/170: 98% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(18), legions_gaze(10), potion_of_the_old_war
1:35.025 maintain K rupture Fluffy_Pillow 123.5/170: 73% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(18), legions_gaze(10), potion_of_the_old_war
1:36.031 build E mutilate Fluffy_Pillow 130.2/170: 77% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(19), legions_gaze(10), potion_of_the_old_war
1:37.035 finish I envenom Fluffy_Pillow 86.9/170: 51% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(19), legions_gaze(10), potion_of_the_old_war
1:38.040 build E mutilate Fluffy_Pillow 83.6/170: 49% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10), potion_of_the_old_war
1:39.045 Waiting     1.000 sec 40.4/170: 24% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10), potion_of_the_old_war
1:40.045 build E mutilate Fluffy_Pillow 72.0/170: 42% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10), potion_of_the_old_war
1:41.050 Waiting     0.600 sec 28.7/170: 17% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10), potion_of_the_old_war
1:41.650 finish I envenom Fluffy_Pillow 35.7/170: 21% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10), potion_of_the_old_war
1:43.930 maintain M garrote Fluffy_Pillow 47.4/170: 28% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10), potion_of_the_old_war
1:44.935 Waiting     1.100 sec 34.1/170: 20% energy | 1.0/5: 20% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10), potion_of_the_old_war
1:46.035 build E mutilate Fluffy_Pillow 66.9/170: 39% energy | 1.0/5: 20% combo_points envenom, the_dreadlords_deceit(24), legions_gaze(10), potion_of_the_old_war
1:47.040 Waiting     1.016 sec 23.6/170: 14% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(24), legions_gaze(10), potion_of_the_old_war
1:48.056 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(25), legions_gaze(10), potion_of_the_old_war
1:49.060 Waiting     1.096 sec 12.2/170: 7% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(25), legions_gaze(10), potion_of_the_old_war
1:50.156 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(26), legions_gaze(10), potion_of_the_old_war
1:51.160 Waiting     1.182 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(26), legions_gaze(10), potion_of_the_old_war
1:52.342 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(27), legions_gaze(10), potion_of_the_old_war
1:53.347 Waiting     1.994 sec 12.2/170: 7% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(27), legions_gaze(10), potion_of_the_old_war
1:55.341 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(28), legions_gaze(10), potion_of_the_old_war
1:56.345 Waiting     0.300 sec 32.2/170: 19% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(29), legions_gaze(10), potion_of_the_old_war
1:56.645 finish I envenom Fluffy_Pillow 35.7/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(29), legions_gaze(10), potion_of_the_old_war
1:57.649 Waiting     1.078 sec 12.4/170: 7% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(29), legions_gaze(10), potion_of_the_old_war
1:58.727 build C fan_of_knives Fluffy_Pillow 45.0/170: 26% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(30), legions_gaze(10)
1:59.732 Waiting     0.880 sec 21.7/170: 13% energy | 1.0/5: 20% combo_points envenom, legions_gaze(10)
2:00.612 maintain M garrote Fluffy_Pillow 52.0/170: 31% energy | 1.0/5: 20% combo_points envenom, the_dreadlords_deceit, legions_gaze(10)
2:01.617 Waiting     1.438 sec 18.7/170: 11% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit, legions_gaze(10)
2:03.055 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 2.0/5: 40% combo_points the_dreadlords_deceit(2), legions_gaze(10)
2:04.059 cds H vanish Fluffy_Pillow 32.2/170: 19% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(3), legions_gaze(10)
2:04.059 maintain J rupture Fluffy_Pillow 32.2/170: 19% energy | 5.0/5: 100% combo_points vanish, the_dreadlords_deceit(3), legions_gaze(10)
2:05.064 Waiting     1.419 sec 18.9/170: 11% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(3), legions_gaze(10)
2:06.483 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(4), legions_gaze(10)
2:07.487 Waiting     1.996 sec 12.2/170: 7% energy | 2.0/5: 40% combo_points the_dreadlords_deceit(4), legions_gaze(10)
2:09.483 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 2.0/5: 40% combo_points the_dreadlords_deceit(5), legions_gaze(10)
2:10.487 Waiting     0.300 sec 32.2/170: 19% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(6), legions_gaze(10)
2:10.787 finish I envenom Fluffy_Pillow 35.7/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(6), legions_gaze(10)
2:11.793 Waiting     1.975 sec 12.4/170: 7% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(6), legions_gaze(10)
2:13.768 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(7), legions_gaze(10)
2:14.773 Waiting     1.300 sec 32.2/170: 19% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(8), legions_gaze(10)
2:16.073 build E mutilate Fluffy_Pillow 67.4/170: 40% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(9), legions_gaze(10)
2:17.077 Waiting     1.000 sec 24.1/170: 14% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(9), legions_gaze(10)
2:18.077 maintain L kingsbane Fluffy_Pillow 55.8/170: 33% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(10), legions_gaze(10)
2:20.101 maintain M garrote Fluffy_Pillow 64.4/170: 38% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(11), legions_gaze(10)
2:21.107 maintain K rupture Fluffy_Pillow 31.1/170: 18% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(11), legions_gaze(10)
2:22.110 Waiting     1.500 sec 37.8/170: 22% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(12), legions_gaze(10)
2:23.610 build E mutilate Fluffy_Pillow 55.3/170: 33% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(12), legions_gaze(10)
2:24.616 Waiting     1.400 sec 32.1/170: 19% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(13), legions_gaze(10)
2:26.016 build E mutilate Fluffy_Pillow 58.4/170: 34% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(14), legions_gaze(10)
2:27.021 Waiting     0.900 sec 25.1/170: 15% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(14), legions_gaze(10)
2:27.921 finish I envenom Fluffy_Pillow 35.6/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(14), legions_gaze(10)
2:28.926 Waiting     1.100 sec 32.3/170: 19% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(15), legions_gaze(10)
2:30.026 build E mutilate Fluffy_Pillow 55.2/170: 32% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(16), legions_gaze(10)
2:31.031 Waiting     1.164 sec 21.9/170: 13% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(16), legions_gaze(10)
2:32.195 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10)
2:33.198 Waiting     1.097 sec 12.2/170: 7% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10)
2:34.295 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(18), legions_gaze(10)
2:35.299 Waiting     1.182 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(18), legions_gaze(10)
2:36.481 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(19), legions_gaze(10)
2:38.760 maintain M garrote Fluffy_Pillow 47.1/170: 28% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10)
2:39.764 Waiting     0.959 sec 13.8/170: 8% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10)
2:40.723 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(21), legions_gaze(10)
2:41.726 Waiting     1.183 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10)
2:42.909 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10)
2:43.914 Waiting     1.095 sec 12.2/170: 7% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10)
2:45.009 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
2:46.014 Waiting     1.200 sec 31.7/170: 19% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(24), legions_gaze(10)
2:47.214 build E mutilate Fluffy_Pillow 55.7/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(24), legions_gaze(10)
2:48.219 Waiting     1.800 sec 32.5/170: 19% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(25), legions_gaze(10)
2:50.019 build E mutilate Fluffy_Pillow 63.5/170: 37% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(26), legions_gaze(10)
2:51.024 Waiting     1.100 sec 30.2/170: 18% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(26), legions_gaze(10)
2:52.124 build E mutilate Fluffy_Pillow 63.0/170: 37% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(27), legions_gaze(10)
2:53.129 Waiting     0.550 sec 19.7/170: 12% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(27), legions_gaze(10)
2:53.679 maintain K rupture Fluffy_Pillow 26.2/170: 15% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(27), legions_gaze(10)
2:55.961 maintain M garrote Fluffy_Pillow 47.8/170: 28% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(28), legions_gaze(10)
2:56.966 Waiting     0.800 sec 24.5/170: 14% energy | 1.0/5: 20% combo_points the_dreadlords_deceit(29), legions_gaze(10)
2:57.766 build C fan_of_knives Fluffy_Pillow 43.8/170: 26% energy | 1.0/5: 20% combo_points the_dreadlords_deceit(29), legions_gaze(10)
2:58.770 Waiting     1.300 sec 30.6/170: 18% energy | 3.0/5: 60% combo_points the_dreadlords_deceit, legions_gaze(10)
3:00.070 build E mutilate Fluffy_Pillow 65.7/170: 39% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(2), legions_gaze(10)
3:01.075 Waiting     0.618 sec 22.5/170: 13% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(2), legions_gaze(10)
3:01.693 finish I envenom Fluffy_Pillow 39.7/170: 23% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(2), legions_gaze(10)
3:02.697 Waiting     0.100 sec 26.4/170: 16% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(3), legions_gaze(10)
3:02.797 cds G vendetta Fluffy_Pillow 27.5/170: 16% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(3), legions_gaze(10)
3:03.015 maintain L kingsbane Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(3), legions_gaze(10)
3:04.082 build E mutilate Fluffy_Pillow 166.7/170: 98% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(4), legions_gaze(10)
3:05.087 finish I envenom Fluffy_Pillow 123.5/170: 73% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(4), legions_gaze(10)
3:06.092 build E mutilate Fluffy_Pillow 120.2/170: 71% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(5), legions_gaze(10)
3:07.097 build E mutilate Fluffy_Pillow 76.9/170: 45% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(5), legions_gaze(10)
3:08.099 finish I envenom Fluffy_Pillow 53.6/170: 32% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(6), legions_gaze(10)
3:09.105 Waiting     0.900 sec 30.3/170: 18% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(6), legions_gaze(10)
3:10.005 build E mutilate Fluffy_Pillow 60.8/170: 36% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(7), legions_gaze(10)
3:11.011 Waiting     1.536 sec 17.6/170: 10% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(7), horrific_appendages, legions_gaze(10)
3:12.547 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(8), horrific_appendages, legions_gaze(10)
3:13.806 maintain K rupture Fluffy_Pillow 25.2/170: 15% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(8), horrific_appendages, legions_gaze(10)
3:16.094 maintain M garrote Fluffy_Pillow 56.9/170: 33% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(10), horrific_appendages, legions_gaze(10)
3:17.100 Waiting     1.018 sec 23.6/170: 14% energy | 1.0/5: 20% combo_points the_dreadlords_deceit(10), horrific_appendages, legions_gaze(10)
3:18.118 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 1.0/5: 20% combo_points the_dreadlords_deceit(11), horrific_appendages, legions_gaze(10)
3:19.123 Waiting     1.095 sec 12.2/170: 7% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(11), horrific_appendages, legions_gaze(10)
3:20.218 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(12), horrific_appendages, legions_gaze(10)
3:21.223 Waiting     1.181 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(12), horrific_appendages, legions_gaze(10)
3:22.404 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(13), legions_gaze(10)
3:23.409 Waiting     1.994 sec 12.2/170: 7% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(13), legions_gaze(10)
3:25.403 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 2.0/5: 40% combo_points the_dreadlords_deceit(14), legions_gaze(10)
3:26.408 Waiting     0.300 sec 32.2/170: 19% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(15), legions_gaze(10)
3:26.708 finish I envenom Fluffy_Pillow 35.7/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(15), legions_gaze(10)
3:27.711 Waiting     2.021 sec 22.4/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(15), legions_gaze(10)
3:29.732 build E mutilate Fluffy_Pillow 66.0/170: 39% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(16), legions_gaze(10)
3:30.736 Waiting     0.200 sec 32.7/170: 19% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10)
3:31.700 maintain M garrote Fluffy_Pillow 54.0/170: 32% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(17), legions_gaze(10)
3:32.704 Waiting     1.300 sec 30.7/170: 18% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(18), legions_gaze(10)
3:34.004 build E mutilate Fluffy_Pillow 65.8/170: 39% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(19), legions_gaze(10)
3:35.008 Waiting     0.309 sec 22.6/170: 13% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(19), legions_gaze(10)
3:35.317 maintain K rupture Fluffy_Pillow 26.2/170: 15% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(19), legions_gaze(10)
3:36.322 Waiting     1.400 sec 32.9/170: 19% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(20), legions_gaze(10)
3:37.722 build E mutilate Fluffy_Pillow 59.2/170: 35% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(20), legions_gaze(10)
3:38.726 Waiting     1.300 sec 25.9/170: 15% energy | 2.0/5: 40% combo_points the_dreadlords_deceit(21), legions_gaze(10)
3:40.026 build E mutilate Fluffy_Pillow 61.1/170: 36% energy | 2.0/5: 40% combo_points the_dreadlords_deceit(22), legions_gaze(10)
3:41.029 Waiting     0.716 sec 17.8/170: 10% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(22), legions_gaze(10)
3:41.745 finish I envenom Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(22), legions_gaze(10)
3:42.749 Waiting     1.281 sec 22.9/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
3:44.030 build E mutilate Fluffy_Pillow 57.8/170: 34% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(24), legions_gaze(10)
3:45.032 Waiting     1.798 sec 14.5/170: 9% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(24), legions_gaze(10)
3:46.830 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(25), legions_gaze(10)
3:47.835 Waiting     0.338 sec 22.2/170: 13% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(25), legions_gaze(10)
3:48.173 maintain L kingsbane Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(26), legions_gaze(10)
3:50.453 maintain M garrote Fluffy_Pillow 47.8/170: 28% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(27), legions_gaze(10)
3:51.458 Waiting     0.900 sec 14.5/170: 9% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(27), legions_gaze(10)
3:52.358 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(28), legions_gaze(10)
3:53.363 Waiting     0.681 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(28), legions_gaze(10)
3:54.044 build C fan_of_knives Fluffy_Pillow 49.7/170: 29% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(29), legions_gaze(10)
3:55.048 Waiting     1.000 sec 26.4/170: 16% energy | 1.0/5: 20% combo_points envenom, legions_gaze(10)
3:56.048 build E mutilate Fluffy_Pillow 58.0/170: 34% energy | 1.0/5: 20% combo_points envenom, the_dreadlords_deceit, legions_gaze(10)
3:57.053 Waiting     0.976 sec 14.8/170: 9% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit, horrific_appendages, legions_gaze(10)
3:58.029 finish I envenom Fluffy_Pillow 46.2/170: 27% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(2), horrific_appendages, legions_gaze(10)
3:59.033 Waiting     1.082 sec 22.9/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(2), horrific_appendages, legions_gaze(10)
4:00.115 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(3), horrific_appendages, legions_gaze(10)
4:01.119 Waiting     1.995 sec 12.2/170: 7% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(3), horrific_appendages, legions_gaze(10)
4:03.114 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(4), horrific_appendages, legions_gaze(10)
4:04.121 cds H vanish Fluffy_Pillow 32.2/170: 19% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(5), horrific_appendages, legions_gaze(10)
4:04.121 maintain J rupture Fluffy_Pillow 32.2/170: 19% energy | 5.0/5: 100% combo_points vanish, the_dreadlords_deceit(5), horrific_appendages, legions_gaze(10)
4:05.123 Waiting     1.420 sec 18.9/170: 11% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(5), horrific_appendages, legions_gaze(10)
4:06.543 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(6), horrific_appendages, legions_gaze(10)
4:08.827 maintain M garrote Fluffy_Pillow 47.1/170: 28% energy | 4.0/5: 80% combo_points the_dreadlords_deceit(7), horrific_appendages, legions_gaze(10)
4:09.831 Waiting     0.200 sec 23.9/170: 14% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(7), horrific_appendages, legions_gaze(10)
4:10.031 finish I envenom Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(8), horrific_appendages, legions_gaze(10)
4:11.035 Waiting     1.936 sec 12.9/170: 8% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(8), horrific_appendages, legions_gaze(10)
4:12.971 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(9), horrific_appendages, legions_gaze(10)
4:13.975 Waiting     1.739 sec 22.2/170: 13% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(9), horrific_appendages, legions_gaze(10)
4:15.714 build E mutilate Fluffy_Pillow 62.5/170: 37% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(10), horrific_appendages, legions_gaze(10)
4:16.719 Waiting     0.500 sec 29.2/170: 17% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(11), horrific_appendages, legions_gaze(10)
4:17.219 finish I envenom Fluffy_Pillow 35.1/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(11), horrific_appendages, legions_gaze(10)
4:18.224 Waiting     1.500 sec 31.8/170: 19% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(12), horrific_appendages, legions_gaze(10)
4:19.724 build E mutilate Fluffy_Pillow 59.3/170: 35% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(12), legions_gaze(10)
4:20.728 Waiting     1.300 sec 26.0/170: 15% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(13), legions_gaze(10)
4:22.028 build E mutilate Fluffy_Pillow 61.2/170: 36% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(14), legions_gaze(10)
4:23.033 Waiting     0.708 sec 17.9/170: 11% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(14), legions_gaze(10)
4:23.741 maintain K rupture Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(14), legions_gaze(10)
4:25.769 maintain M garrote Fluffy_Pillow 54.8/170: 32% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(15), legions_gaze(10)
4:26.774 Waiting     1.200 sec 31.5/170: 19% energy | 1.0/5: 20% combo_points the_dreadlords_deceit(16), legions_gaze(10)
4:27.974 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 1.0/5: 20% combo_points the_dreadlords_deceit(16), legions_gaze(10)
4:28.979 Waiting     0.733 sec 22.3/170: 13% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(17), legions_gaze(10)
4:29.712 finish I envenom Fluffy_Pillow 40.8/170: 24% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(17), legions_gaze(10)
4:30.717 Waiting     1.300 sec 27.6/170: 16% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(18), legions_gaze(10)
4:32.017 build E mutilate Fluffy_Pillow 62.7/170: 37% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(19), legions_gaze(10)
4:33.022 cds G vendetta Fluffy_Pillow 19.4/170: 11% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(19), legions_gaze(10)
4:33.022 maintain L kingsbane Fluffy_Pillow 170.0/170: 100% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(19), legions_gaze(10)
4:34.176 finish I envenom Fluffy_Pillow 166.7/170: 98% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10)
4:35.181 build E mutilate Fluffy_Pillow 143.4/170: 84% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(20), legions_gaze(10)
4:36.185 finish I envenom Fluffy_Pillow 120.1/170: 71% energy | 4.0/5: 80% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10)
4:37.190 build E mutilate Fluffy_Pillow 96.9/170: 57% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(21), legions_gaze(10)
4:38.194 build E mutilate Fluffy_Pillow 73.6/170: 43% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10)
4:39.197 Waiting     0.500 sec 30.3/170: 18% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10)
4:39.697 finish I envenom Fluffy_Pillow 46.1/170: 27% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(22), legions_gaze(10)
4:40.704 Waiting     1.100 sec 32.9/170: 19% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
4:41.804 build E mutilate Fluffy_Pillow 55.7/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(23), legions_gaze(10)
4:44.084 maintain M garrote Fluffy_Pillow 57.3/170: 34% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(25), legions_gaze(10)
4:45.086 Waiting     1.000 sec 24.0/170: 14% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(25), legions_gaze(10)
4:46.086 build E mutilate Fluffy_Pillow 55.7/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(26), legions_gaze(10)
4:47.091 Waiting     1.080 sec 12.4/170: 7% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(26), legions_gaze(10)
4:48.171 maintain K rupture Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(27), legions_gaze(10)
4:49.177 Waiting     0.900 sec 31.7/170: 19% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(27), legions_gaze(10)
4:50.077 build E mutilate Fluffy_Pillow 62.2/170: 37% energy | 0.0/5: 0% combo_points the_dreadlords_deceit(28), legions_gaze(10)
4:51.082 Waiting     0.918 sec 19.0/170: 11% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(28), legions_gaze(10)
4:52.000 build C fan_of_knives Fluffy_Pillow 49.7/170: 29% energy | 3.0/5: 60% combo_points the_dreadlords_deceit(29), legions_gaze(10)
4:53.003 Waiting     0.700 sec 26.4/170: 16% energy | 5.0/5: 100% combo_points legions_gaze(10)
4:53.703 finish I envenom Fluffy_Pillow 44.5/170: 26% energy | 5.0/5: 100% combo_points legions_gaze(10)
4:54.706 Waiting     1.200 sec 31.2/170: 18% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit, legions_gaze(10)
4:55.906 build E mutilate Fluffy_Pillow 55.2/170: 32% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit, legions_gaze(10)
4:56.911 Waiting     1.160 sec 22.0/170: 13% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(2), legions_gaze(10)
4:58.071 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 3.0/5: 60% combo_points envenom, the_dreadlords_deceit(3), legions_gaze(10)
4:59.078 Waiting     1.092 sec 12.2/170: 7% energy | 5.0/5: 100% combo_points envenom, the_dreadlords_deceit(3), legions_gaze(10)
5:00.170 finish I envenom Fluffy_Pillow 45.0/170: 26% energy | 5.0/5: 100% combo_points the_dreadlords_deceit(4), legions_gaze(10)
5:01.174 Waiting     1.182 sec 21.7/170: 13% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(4), legions_gaze(10)
5:02.356 build E mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, the_dreadlords_deceit(5), legions_gaze(10)
5:03.360 Waiting     1.096 sec 12.2/170: 7% energy | 2.0/5: 40% combo_points envenom, the_dreadlords_deceit(5), legions_gaze(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 27259 25553 15303 (11987)
Stamina 41845 41845 25027
Intellect 5325 5000 0
Spirit 0 0 0
Health 2510700 2510700 0
Energy 170 170 0
Combo Points 5 5 0
Crit 32.44% 32.44% 8576
Haste 6.07% 6.07% 2276
Damage / Heal Versatility 4.12% 3.33% 1584
Attack Power 27259 25553 0
Mastery 117.80% 117.80% 8578
Armor 2166 2166 2166
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 875.00
Local Head Cowl of Fright
ilevel: 875, stats: { 291 Armor, +2577 Sta, +1719 AgiInt, +978 Mastery, +527 Crit }
Local Neck Raven Filigree Pendant
ilevel: 875, stats: { +1450 Sta, +1584 Vers, +936 Mastery }
Local Shoulders Spaulders of Aberrant Inhibition
ilevel: 880, stats: { 273 Armor, +1351 AgiInt, +2027 Sta, +822 Mastery, +328 Crit, +493 Avoidance }
Local Chest Spell Fencer's Jacket
ilevel: 850, stats: { 329 Armor, +1362 AgiInt, +2042 Sta, +783 Mastery, +587 Crit }
Local Waist Swordsinger's Belt
ilevel: 870, stats: { 198 Armor, +1231 AgiInt, +1846 Sta, +673 Mastery, +435 Haste }
Local Legs Charskin Legguards
ilevel: 855, stats: { 293 Armor, +1427 AgiInt, +2140 Sta, +848 Mastery, +548 Crit }
Local Feet Moccasins of Silent Passage
ilevel: 875, stats: { 246 Armor, +1933 Sta, +1289 AgiInt, +733 Crit, +394 Haste }
Local Wrists Bracers of Impossible Choices
ilevel: 880, stats: { 159 Armor, +1519 Sta, +1013 AgiInt, +616 Crit, +246 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 865, stats: { 216 Armor, +1174 AgiInt, +1762 Sta, +753 Crit, +333 Haste }, gems: { +150 Mastery }
Local Finger1 Val'kyr Ascension Signet
ilevel: 840, stats: { +1047 Sta, +1223 Crit, +815 Mastery }
Local Finger2 Insignia of Ravenholdt
ilevel: 910, stats: { +2010 Sta, +2004 Crit, +1114 Haste }, gems: { +200 Agi }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 865, stats: { +1036 Mastery }
Local Trinket2 Eye of Command
ilevel: 860, stats: { +1421 StrAgi }
Local Back The Dreadlord's Deceit
ilevel: 910, stats: { 161 Armor, +2010 Sta, +1340 Agi, +551 Crit, +413 Mastery }
Local Main Hand The Kingslayers
ilevel: 895, weapon: { 3469 - 6444, 1.8 }, stats: { +888 Agi, +1332 Sta, +353 Crit, +339 Mastery }, relics: { +45 ilevels, +51 ilevels, +49 ilevels }
Local Off Hand The Kingslayers
ilevel: 895, weapon: { 3469 - 6444, 1.8 }, stats: { +888 Agi, +1332 Sta, +353 Crit, +339 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Splouch"
origin="https://eu.api.battle.net/wow/character/hyjal/Splouch/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/194/146864578-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=attack
position=back
professions=leatherworking=800/skinning=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ca!0022000
artifact=43:0:0:0:0:323:1:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1:1384:5
spec=assassination

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=call_action_list,name=cds
actions+=/call_action_list,name=maintain
# The 'active_dot.rupture>=spell_targets.rupture' means that we don't want to envenom as long as we can multi-rupture (i.e. units that don't have rupture yet).
actions+=/call_action_list,name=finish,if=(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)&(!dot.rupture.refreshable|(dot.rupture.exsanguinated&dot.rupture.remains>=3.5)|target.time_to_die-dot.rupture.remains<=4)&active_dot.rupture>=spell_targets.rupture
actions+=/call_action_list,name=build,if=(combo_points.deficit>0|energy.time_to_max<1)

# Builders
actions.build=hemorrhage,if=refreshable
actions.build+=/hemorrhage,cycle_targets=1,if=refreshable&dot.rupture.ticking&spell_targets.fan_of_knives<=3
actions.build+=/fan_of_knives,if=spell_targets>=3|buff.the_dreadlords_deceit.stack>=29
actions.build+=/mutilate,cycle_targets=1,if=(!talent.agonizing_poison.enabled&dot.deadly_poison_dot.refreshable)|(talent.agonizing_poison.enabled&debuff.agonizing_poison.remains<debuff.agonizing_poison.duration*0.3)|(set_bonus.tier19_2pc=1&dot.mutilated_flesh.refreshable)
actions.build+=/mutilate

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions.cds+=/blood_fury,if=debuff.vendetta.up
actions.cds+=/berserking,if=debuff.vendetta.up
actions.cds+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<5&dot.rupture.ticking
actions.cds+=/vendetta,if=talent.exsanguinate.enabled&(artifact.master_assassin.rank>=4-equipped.convergence_of_fates|equipped.duskwalkers_footpads)&energy.deficit>=75&!(artifact.master_assassin.rank=5-equipped.convergence_of_fates&equipped.duskwalkers_footpads)
actions.cds+=/vendetta,if=!talent.exsanguinate.enabled&energy.deficit>=88-!talent.venom_rush.enabled*10
actions.cds+=/vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&((talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&(dot.rupture.ticking|time>10))|(!talent.exsanguinate.enabled&dot.rupture.refreshable))
actions.cds+=/vanish,if=talent.subterfuge.enabled&dot.garrote.refreshable&((spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives)|(spell_targets.fan_of_knives>=4&combo_points.deficit>=4))
actions.cds+=/vanish,if=talent.shadow_focus.enabled&energy.time_to_max>=2&combo_points.deficit>=4
actions.cds+=/exsanguinate,if=prev_gcd.1.rupture&dot.rupture.remains>4+4*cp_max_spend

# Finishers
actions.finish=death_from_above,if=combo_points>=cp_max_spend
actions.finish+=/envenom,if=combo_points>=4|(talent.elaborate_planning.enabled&combo_points>=3+!talent.exsanguinate.enabled&buff.elaborate_planning.remains<0.1)

# Maintain
actions.maintain=rupture,if=(talent.nightstalker.enabled&stealthed.rogue)|(talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2+artifact.urge_to_kill.enabled))))
actions.maintain+=/rupture,cycle_targets=1,if=combo_points>=cp_max_spend-talent.exsanguinate.enabled&refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4
actions.maintain+=/kingsbane,if=(talent.exsanguinate.enabled&dot.rupture.exsanguinated)|(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))
actions.maintain+=/pool_resource,for_next=1
actions.maintain+=/garrote,cycle_targets=1,if=refreshable&(!exsanguinated|remains<=1.5)&target.time_to_die-remains>4

head=cowl_of_fright,id=139205,bonus_id=1805/1497/3336
neck=raven_filigree_pendant,id=134499,bonus_id=3417/1527/3337
shoulders=spaulders_of_aberrant_inhibition,id=134453,bonus_id=3509/40/1532/3336
back=the_dreadlords_deceit,id=137021,bonus_id=1811/3458
chest=spell_fencers_jacket,id=139953,bonus_id=3474/1512/3336
wrists=bracers_of_impossible_choices,id=140889,bonus_id=3514/1477/3336
hands=guileful_intruder_handguards,id=137480,bonus_id=3416/1808/1517/3336,gems=150mastery
waist=swordsingers_belt,id=134287,bonus_id=3416/1532/3336
legs=charskin_legguards,id=137353,bonus_id=3413/1507/3336
feet=moccasins_of_silent_passage,id=142417,bonus_id=3468/1492
finger1=valkyr_ascension_signet,id=133679,bonus_id=1727/1492/1813
finger2=insignia_of_ravenholdt,id=137049,bonus_id=1811/3458,gems=200agi,enchant=200mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1805/1487
trinket2=eye_of_command,id=142167,bonus_id=3453/1472
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=141273/139261/139257/0,relic_id=3474:1517:3336/1805:1497:3336/1805:1492:3336/0
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=875.00
# gear_agility=15303
# gear_stamina=25027
# gear_crit_rating=8576
# gear_haste_rating=2276
# gear_mastery_rating=8578
# gear_versatility_rating=1584
# gear_avoidance_rating=493
# gear_armor=2166

Dèmonos

Dèmonos : 350638 dps

  • Race: Human
  • Class: Warlock
  • Spec: Destruction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
350638.0 350638.0 196.6 / 0.056% 39348.1 / 11.2% 7.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
31529.7 31529.7 Mana 0.00% 46.4 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Dèmonos/advanced
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Reverse Entropy (Destruction Warlock)
  • 45: Shadowfury
  • 60: Fire and Brimstone (Destruction Warlock)
  • 75: Burning Rush
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact
Professions
  • tailoring: 246
  • enchanting: 730

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Dèmonos 350638
Chaos Bolt 63324 18.1% 32.4 9.01sec 586814 384537 Direct 33.2 0 573867 573867 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.44 33.17 0.00 0.00 1.5261 0.0000 19034559.61 19034559.61 0.00 384536.56 384536.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 33.17 100.00% 573866.59 414316 733624 573891.08 516755 643575 19034560 19034560 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 27392 7.8% 33.5 9.04sec 245569 212314 Direct 33.5 140514 322681 245572 57.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.52 33.52 0.00 0.00 1.1567 0.0000 8230757.81 8230757.81 0.00 212313.51 212313.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.19 42.33% 140514.25 101383 179517 140511.27 111845 164193 1993673 1993673 0.00
crit 19.33 57.67% 322680.53 202769 422079 322645.15 277560 372583 6237085 6237085 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 9098 2.6% 24.7 12.23sec 109101 0 Direct 24.7 92909 185818 109102 17.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.67 24.67 0.00 0.00 0.0000 0.0000 2692053.95 2692053.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.37 82.57% 92909.23 92909 92909 92909.23 92909 92909 1892992 1892992 0.00
crit 4.30 17.43% 185818.46 185818 185818 183774.25 0 185818 799062 799062 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 43024 12.3% 17.3 17.82sec 748899 642368 Direct 17.3 97443 194897 153738 57.8%  
Periodic 128.6 50719 101510 79923 57.5% 99.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 17.27 128.63 128.63 1.1659 2.3147 12936647.02 12936647.02 0.00 40696.00 642367.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.30 42.23% 97443.47 70337 124546 97449.41 0 120821 710910 710910 0.00
crit 9.98 57.77% 194896.51 140677 249090 194879.48 150393 235465 1944782 1944782 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.7 42.50% 50718.84 1595 64866 50718.63 46690 55626 2772809 2772809 0.00
crit 74.0 57.50% 101509.50 3422 129733 101506.44 93631 109329 7508146 7508146 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.40
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 77344 22.1% 126.4 2.33sec 184000 139318 Direct 125.6 157536 315078 185209 17.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.44 125.61 0.00 0.00 1.3207 0.0000 23264648.91 23264648.91 0.00 139317.62 139317.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.55 82.43% 157535.92 113700 201328 157530.93 146273 166636 16311935 16311935 0.00
crit 22.07 17.57% 315077.53 227400 402655 315071.49 271136 355739 6952714 6952714 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 6209 1.8% 18.4 16.15sec 101194 0 Direct 18.4 86057 172114 101193 17.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.44 18.44 0.00 0.00 0.0000 0.0000 1866155.91 1866155.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.20 82.41% 86057.18 86057 86057 86057.18 86057 86057 1307864 1307864 0.00
crit 3.24 17.59% 172114.37 172114 172114 166244.68 0 172114 558292 558292 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Plague Swarm 14020 4.0% 14.7 20.37sec 287496 0 Periodic 64.8 55410 110787 65107 17.5% 42.3%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 64.76 64.76 0.0000 1.9641 4216265.10 4216265.10 0.00 33149.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.4 82.49% 55410.48 28 56392 55436.92 51968 56392 2960001 2960001 0.00
crit 11.3 17.51% 110787.11 56 112785 110842.11 76750 112785 1256265 1256265 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:48055.03
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Tormenting Cyclone 4849 1.4% 11.0 26.23sec 132844 0 Direct 75.4 16441 32881 19324 17.5%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.98 75.45 0.00 0.00 0.0000 0.0000 1457972.50 1457972.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.22 82.46% 16440.68 16441 16441 16440.68 16441 16441 1022882 1022882 0.00
crit 13.23 17.54% 32881.37 32881 32881 32871.50 0 32881 435090 435090 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
pet - imp 27778 / 27778
Firebolt 27778 7.9% 100.4 3.00sec 83132 61406 Direct 99.6 71275 142539 83781 17.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.42 99.64 0.00 0.00 1.3538 0.0000 8347995.58 8347995.58 0.00 61405.80 61405.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.15 82.45% 71274.66 47676 71514 71271.34 70781 71514 5855470 5855470 0.00
crit 17.49 17.55% 142538.63 95352 143029 142533.73 135082 143029 2492526 2492526 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 78222 / 25044
Firebolt 78222 7.1% 45.0 6.05sec 167220 127698 Direct 44.7 143028 286055 168116 17.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.97 44.73 0.00 0.00 1.3095 0.0000 7519212.65 7519212.65 0.00 127697.51 127697.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.88 82.46% 143027.74 95352 143029 143027.76 141539 143029 5275033 5275033 0.00
crit 7.85 17.54% 286054.60 190705 286057 285968.65 0 286057 2244180 2244180 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 37963 / 3208
Immolation 23768 0.6% 1.0 0.00sec 594213 0 Periodic 20.0 25252 50503 29710 17.7% 8.3%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 20.00 20.00 0.0000 1.2410 594212.55 594212.55 0.00 23941.84 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.5 82.34% 25251.52 25252 25252 25251.52 25252 25252 415848 415848 0.00
crit 3.5 17.66% 50503.04 50503 50503 49558.54 0 50503 178364 178364 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 14196 0.3% 20.0 1.24sec 17745 14300 Direct 20.0 15100 30201 17746 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 1.2410 0.0000 354902.86 521740.82 31.98 14299.64 14299.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.50 82.49% 15100.48 15100 15100 15100.48 15100 15100 249116 366225 31.98
crit 3.50 17.51% 30200.96 30201 30201 29563.66 0 30201 105786 155516 31.30
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 62631 / 5293
Doom Bolt 62631 1.5% 10.0 2.42sec 156584 64704 Direct 10.0 133329 266659 156590 17.4%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 10.00 0.00 0.00 2.4200 0.0000 1565843.16 1565843.16 0.00 64704.26 64704.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.26 82.56% 133329.35 133329 133329 133329.35 133329 133329 1100744 1100744 0.00
crit 1.74 17.44% 266658.70 266659 266659 227429.29 0 266659 465099 465099 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 37988 / 3210
Immolation 23778 0.6% 1.0 0.00sec 594468 0 Periodic 20.0 25252 50503 29723 17.7% 8.3%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 20.00 20.00 0.0000 1.2410 594467.62 594467.62 0.00 23952.12 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.5 82.29% 25251.52 25252 25252 25251.52 25252 25252 415593 415593 0.00
crit 3.5 17.71% 50503.04 50503 50503 49437.32 0 50503 178874 178874 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 14210 0.3% 20.0 1.24sec 17763 14314 Direct 20.0 15100 30201 17763 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 1.2410 0.0000 355260.78 522267.00 31.98 14314.06 14314.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.47 82.37% 15100.48 15100 15100 15100.48 15100 15100 248759 365699 31.98
crit 3.53 17.63% 30200.96 30201 30201 29530.44 0 30201 106502 156568 31.27
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 37947 / 3207
Immolation 23762 0.6% 1.0 0.00sec 594071 0 Periodic 20.0 25252 50503 29704 17.6% 8.3%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 20.00 20.00 0.0000 1.2410 594071.13 594071.13 0.00 23936.14 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.5 82.37% 25251.52 25252 25252 25251.52 25252 25252 415990 415990 0.00
crit 3.5 17.63% 50503.04 50503 50503 49497.93 0 50503 178081 178081 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 14186 0.3% 20.0 1.24sec 17733 14290 Direct 20.0 15100 30201 17733 17.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 1.2410 0.0000 354653.68 521374.50 31.98 14289.60 14289.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.51 82.57% 15100.48 15100 15100 15100.48 15100 15100 249366 366591 31.98
crit 3.49 17.43% 30200.96 30201 30201 29518.35 0 30201 105288 154783 31.25
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 37949 / 3207
Immolation 23744 0.6% 1.0 0.00sec 593629 0 Periodic 20.0 25252 50503 29681 17.5% 8.3%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 20.00 20.00 0.0000 1.2410 593629.19 593629.19 0.00 23918.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.5 82.46% 25251.52 25252 25252 25251.52 25252 25252 416432 416432 0.00
crit 3.5 17.54% 50503.04 50503 50503 49482.78 0 50503 177198 177198 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 14205 0.3% 20.0 1.24sec 17757 14309 Direct 20.0 15100 30201 17757 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 1.2410 0.0000 355139.96 522089.39 31.98 14309.20 14309.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.48 82.41% 15100.48 15100 15100 15100.48 15100 15100 248879 365876 31.98
crit 3.52 17.59% 30200.96 30201 30201 29590.84 0 30201 106261 156213 31.33
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 72705 / 14352
Shadow Bolt 72705 4.1% 5.2 53.91sec 823685 0 Periodic 49.1 74424 148783 87522 17.6% 23.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 0.00 49.38 49.12 0.0000 1.4393 4298890.80 4298890.80 0.00 60481.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 82.38% 74423.72 4913 77698 74431.28 0 77698 3011478 3011478 0.00
crit 8.7 17.62% 148782.70 9827 155396 147895.79 0 155396 1287413 1287413 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 97222 / 7685
Chaos Bolt 97222 2.2% 5.1 51.98sec 453175 199063 Direct 5.0 0 456705 456705 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.09 5.05 0.00 0.00 2.2766 0.0000 2305750.45 2305750.45 0.00 199063.32 199063.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 5.05 100.00% 456705.38 456705 456705 456567.92 0 456705 2305750 2305750 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 144264 / 12500
Chaos Barrage 144264 3.6% 5.2 53.59sec 725106 0 Periodic 152.1 20938 41893 24626 17.6% 9.3%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 0.00 152.79 152.10 0.0000 0.1836 3745664.92 3745664.92 0.00 133563.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.3 82.40% 20937.86 532 21368 20930.99 0 21368 2624255 2624255 0.00
crit 26.8 17.60% 41893.18 1063 42735 41878.72 0 42735 1121410 1121410 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Dèmonos
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
Dimensional Rift 15.5 20.76sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 0.00 0.00 0.00 1.1438 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.85sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 1.1384 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.2145 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.9345 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 33.5 0.0 9.0sec 9.0sec 44.67% 34.23% 0.0(0.0) 1.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:14.65%
  • backdraft_2:30.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 19.98% 0.0(0.0) 1.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 16.8 0.0 17.6sec 17.6sec 50.68% 48.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:50.68%

Trigger Attempt Success

  • trigger_pct:50.18%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.74% 98.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 255.3sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 5.2 51.6sec
chaos_tear 5.1 51.9sec
chaos_portal 5.2 52.0sec
dimension_ripper 6.3 39.6sec

Resources

Resource Usage Type Count Total Average RPE APR
Dèmonos
chaos_bolt Soul Shard 33.4 66.9 2.0 2.1 284634.9
immolate Mana 17.3 1140084.5 66000.0 65999.2 11.3
incinerate Mana 126.4 8344960.3 66000.0 66000.3 2.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 100.4 4016.7 40.0 40.0 2078.3
pet - service_imp
firebolt Energy 45.0 1798.7 40.0 40.0 4180.3
pet - doomguard
doom_bolt Energy 10.0 350.0 35.0 35.0 4473.8
Resource Gains Type Count Total Average Overflow
immolate Soul Shard 30.41 30.41 (43.06%) 1.00 0.00 0.00%
conflagrate Soul Shard 33.52 33.52 (47.46%) 1.00 0.00 0.00%
mp5_regen Mana 513.38 3617899.45 (38.79%) 7047.15 645343.63 15.14%
reverse_entropy Mana 33.44 5710065.57 (61.21%) 170771.92 7163100.22 55.64%
soulsnatcher Soul Shard 6.69 6.69 (9.48%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1846.31 3850.56 (100.00%) 2.09 22.74 0.59%
pet - service_imp
energy_regen Energy 405.29 1209.20 (100.00%) 2.98 64.04 5.03%
pet - doomguard
energy_regen Energy 10.00 315.00 (100.00%) 31.50 44.97 12.49%
Resource RPS-Gain RPS-Loss
Mana 31007.68 31529.70
Soul Shard 0.23 0.24
Combat End Resource Mean Min Max
Mana 939141.56 315375.26 1100000.00
Soul Shard 1.12 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.8%

Statistics & Data Analysis

Fight Length
Sample Data Dèmonos Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Dèmonos Damage Per Second
Count 9999
Mean 350638.01
Minimum 320485.07
Maximum 390459.60
Spread ( max - min ) 69974.53
Range [ ( max - min ) / 2 * 100% ] 9.98%
Standard Deviation 10031.6981
5th Percentile 335160.40
95th Percentile 368152.20
( 95th Percentile - 5th Percentile ) 32991.80
Mean Distribution
Standard Deviation 100.3220
95.00% Confidence Intervall ( 350441.38 - 350834.63 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3145
0.1 Scale Factor Error with Delta=300 859078
0.05 Scale Factor Error with Delta=300 3436312
0.01 Scale Factor Error with Delta=300 85907796
Priority Target DPS
Sample Data Dèmonos Priority Target Damage Per Second
Count 9999
Mean 350638.01
Minimum 320485.07
Maximum 390459.60
Spread ( max - min ) 69974.53
Range [ ( max - min ) / 2 * 100% ] 9.98%
Standard Deviation 10031.6981
5th Percentile 335160.40
95th Percentile 368152.20
( 95th Percentile - 5th Percentile ) 32991.80
Mean Distribution
Standard Deviation 100.3220
95.00% Confidence Intervall ( 350441.38 - 350834.63 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3145
0.1 Scale Factor Error with Delta=300 859078
0.05 Scale Factor Error with Delta=300 3436312
0.01 Scale Factor Error with Delta=300 85907796
DPS(e)
Sample Data Dèmonos Damage Per Second (Effective)
Count 9999
Mean 350638.01
Minimum 320485.07
Maximum 390459.60
Spread ( max - min ) 69974.53
Range [ ( max - min ) / 2 * 100% ] 9.98%
Damage
Sample Data Dèmonos Damage
Count 9999
Mean 73699060.80
Minimum 52204595.60
Maximum 96788090.56
Spread ( max - min ) 44583494.96
Range [ ( max - min ) / 2 * 100% ] 30.25%
DTPS
Sample Data Dèmonos Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dèmonos Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Dèmonos Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dèmonos Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dèmonos Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Dèmonos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DèmonosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Dèmonos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.00 dimensional_rift,if=charges=3
D 3.16 immolate,if=remains<=tick_time
0.00 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
0.00 berserking
0.00 blood_fury
0.00 arcane_torrent
E 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
F 17.21 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
G 0.51 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
H 3.68 service_pet
I 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
J 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
K 14.48 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
L 32.61 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
M 15.80 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
N 14.18 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
O 127.01 incinerate
0.00 life_tap

Sample Sequence

0126ABCDFHIKKOOGLOMOOLNOFLLOOOOMOLOOOFLNOOOOMLOOOKOFKLNOKLOFLOOOLMNOOOOOOMLOOOOFLDKOOOOFHOOOONLMLOOLOFOOOONOFLOOLOKLMONOOOFLOOOOOMLNOOLMOLOOOOMOLNOKOOMLOOOHOMLNOOOOMLOOOOLMDOOOOOMLKOOOKFDLOKOOOFLJOONOFLOOOOEOKMLOKNOFKOOOOOLMHNOOOOFLOOOOOFLN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:00.935 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:01.870 default F conflagrate Fluffy_Pillow 1034088.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:02.804 default H service_imp Fluffy_Pillow 1050644.6/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, backdraft(2), conflagration_of_chaos, potion_of_deadly_grace
0:03.739 default I summon_infernal Fluffy_Pillow 1067218.3/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, backdraft(2), conflagration_of_chaos, potion_of_deadly_grace
0:04.673 default K dimensional_rift Fluffy_Pillow 1083774.3/1100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:05.606 default K dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:06.540 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:07.360 default O incinerate Fluffy_Pillow 1034070.9/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:08.181 default G conflagrate Fluffy_Pillow 982623.9/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:09.117 default L chaos_bolt Fluffy_Pillow 999215.3/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:10.206 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:11.025 default M conflagrate Fluffy_Pillow 1034053.2/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:11.960 default O incinerate Fluffy_Pillow 1050626.9/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_deadly_grace
0:12.781 default O incinerate Fluffy_Pillow 999179.9/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:13.600 default L chaos_bolt Fluffy_Pillow 947697.4/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:15.157 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:16.091 default O incinerate Fluffy_Pillow 1034070.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:17.263 default F conflagrate Fluffy_Pillow 988845.7/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:18.198 default L chaos_bolt Fluffy_Pillow 1005419.4/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:19.287 default L chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:20.376 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:21.548 default O incinerate Fluffy_Pillow 1034106.4/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:22.717 default O incinerate Fluffy_Pillow 988827.9/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:23.887 default O incinerate Fluffy_Pillow 943567.2/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:25.057 default M conflagrate Fluffy_Pillow 898306.5/1100000: 82% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:25.991 default O incinerate Fluffy_Pillow 914862.5/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, backdraft(2), lord_of_flames
0:26.812 default L chaos_bolt Fluffy_Pillow 863415.5/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames
0:27.901 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames
0:29.071 default O incinerate Fluffy_Pillow 1034070.9/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames
0:30.241 default O incinerate Fluffy_Pillow 988810.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames
0:31.411 default F conflagrate Fluffy_Pillow 943549.5/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames
0:32.589 default L chaos_bolt Fluffy_Pillow 964430.6/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos
0:33.679 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos
0:34.614 default O incinerate Fluffy_Pillow 1034088.6/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos
0:35.435 default O incinerate Fluffy_Pillow 982641.6/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:36.605 default O incinerate Fluffy_Pillow 937380.9/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:37.776 default O incinerate Fluffy_Pillow 892137.9/1100000: 81% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:38.947 default M conflagrate Fluffy_Pillow 846894.9/1100000: 77% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:40.049 default L chaos_bolt Fluffy_Pillow 864686.3/1100000: 79% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
0:41.464 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
0:42.531 default O incinerate Fluffy_Pillow 1034081.8/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
0:44.052 default O incinerate Fluffy_Pillow 988821.1/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames
0:45.572 default K dimensional_rift Fluffy_Pillow 943546.8/1100000: 86% mana | 0.0/5: 0% soul_shard lord_of_flames
0:46.785 default O incinerate Fluffy_Pillow 960086.4/1100000: 87% mana | 1.0/5: 20% soul_shard lord_of_flames
0:48.303 default F conflagrate Fluffy_Pillow 914784.8/1100000: 83% mana | 1.0/5: 20% soul_shard lord_of_flames
0:49.721 default K dimensional_rift Fluffy_Pillow 934119.7/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
0:50.936 default L chaos_bolt Fluffy_Pillow 950686.6/1100000: 86% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames
0:52.351 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
0:53.565 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
0:54.630 default K dimensional_rift Fluffy_Pillow 982576.1/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames
0:55.845 default L chaos_bolt Fluffy_Pillow 999143.0/1100000: 91% mana | 2.0/5: 40% soul_shard lord_of_flames
0:57.866 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
0:59.387 default F conflagrate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
1:00.602 default L chaos_bolt Fluffy_Pillow 1050635.1/1100000: 96% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:02.016 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:03.081 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:04.601 default O incinerate Fluffy_Pillow 988780.2/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:06.122 default L chaos_bolt Fluffy_Pillow 943519.5/1100000: 86% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:08.143 default M conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
1:09.357 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:10.569 default O incinerate Fluffy_Pillow 1034027.3/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:11.634 default O incinerate Fluffy_Pillow 982548.9/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:12.699 default O incinerate Fluffy_Pillow 931070.5/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:14.220 default O incinerate Fluffy_Pillow 885809.8/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:15.738 default O incinerate Fluffy_Pillow 840508.2/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:17.259 default O incinerate Fluffy_Pillow 795247.5/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:18.777 default M conflagrate Fluffy_Pillow 749945.9/1100000: 68% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:19.991 default L chaos_bolt Fluffy_Pillow 766499.1/1100000: 70% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
1:21.404 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
1:22.470 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
1:23.992 default O incinerate Fluffy_Pillow 988821.1/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames
1:25.513 default O incinerate Fluffy_Pillow 943560.4/1100000: 86% mana | 0.0/5: 0% soul_shard lord_of_flames
1:27.032 default F conflagrate Fluffy_Pillow 898272.4/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames
1:28.446 default L chaos_bolt Fluffy_Pillow 917552.8/1100000: 83% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
1:29.862 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
1:31.077 default K dimensional_rift Fluffy_Pillow 1034068.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
1:32.291 default O incinerate Fluffy_Pillow 1050621.4/1100000: 96% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
1:33.358 default O incinerate Fluffy_Pillow 999170.3/1100000: 91% mana | 0.0/5: 0% soul_shard lord_of_flames
1:34.879 default O incinerate Fluffy_Pillow 953909.6/1100000: 87% mana | 0.0/5: 0% soul_shard lord_of_flames
1:36.400 default O incinerate Fluffy_Pillow 908648.9/1100000: 83% mana | 0.0/5: 0% soul_shard lord_of_flames
1:37.922 default F conflagrate Fluffy_Pillow 863401.9/1100000: 78% mana | 0.0/5: 0% soul_shard lord_of_flames
1:39.138 default H service_imp Fluffy_Pillow 879982.4/1100000: 80% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:40.352 default O incinerate Fluffy_Pillow 896535.6/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:41.417 default O incinerate Fluffy_Pillow 845057.2/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:42.481 default O incinerate Fluffy_Pillow 793565.2/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:44.000 default O incinerate Fluffy_Pillow 748277.2/1100000: 68% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:45.520 default N immolate Fluffy_Pillow 703002.9/1100000: 64% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:46.733 default L chaos_bolt Fluffy_Pillow 653542.5/1100000: 59% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:48.754 default M conflagrate Fluffy_Pillow 1066099.5/1100000: 97% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:49.970 default L chaos_bolt Fluffy_Pillow 1082680.0/1100000: 98% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
1:51.386 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:52.452 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
1:53.974 default L chaos_bolt Fluffy_Pillow 988821.1/1100000: 90% mana | 2.0/5: 40% soul_shard lord_of_flames
1:55.993 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
1:57.513 default F conflagrate Fluffy_Pillow 1034054.5/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
1:58.728 default O incinerate Fluffy_Pillow 1050621.4/1100000: 96% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames
1:59.792 default O incinerate Fluffy_Pillow 999129.4/1100000: 91% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:00.856 default O incinerate Fluffy_Pillow 947637.4/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames
2:02.378 default O incinerate Fluffy_Pillow 902390.3/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames
2:03.899 default N immolate Fluffy_Pillow 857129.6/1100000: 78% mana | 1.0/5: 20% soul_shard lord_of_flames
2:05.112 default O incinerate Fluffy_Pillow 807669.2/1100000: 73% mana | 1.0/5: 20% soul_shard lord_of_flames
2:06.634 default F conflagrate Fluffy_Pillow 762422.2/1100000: 69% mana | 2.0/5: 40% soul_shard lord_of_flames
2:07.849 default L chaos_bolt Fluffy_Pillow 778989.1/1100000: 71% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:09.266 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:10.330 default O incinerate Fluffy_Pillow 1034040.9/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:11.850 default L chaos_bolt Fluffy_Pillow 988766.6/1100000: 90% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:13.871 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:15.391 default K dimensional_rift Fluffy_Pillow 1034054.5/1100000: 94% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:16.607 default L chaos_bolt Fluffy_Pillow 1050635.1/1100000: 96% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:18.627 default M conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:19.842 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames
2:20.907 default N immolate Fluffy_Pillow 1034054.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:22.121 default O incinerate Fluffy_Pillow 984607.8/1100000: 90% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:23.186 default O incinerate Fluffy_Pillow 933129.4/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
2:24.706 default O incinerate Fluffy_Pillow 887855.1/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
2:26.227 default F conflagrate Fluffy_Pillow 842594.4/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames
2:27.440 default L chaos_bolt Fluffy_Pillow 859134.0/1100000: 78% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:28.855 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:29.921 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:31.442 default O incinerate Fluffy_Pillow 988807.5/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:32.963 default O incinerate Fluffy_Pillow 943546.8/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:34.484 default O incinerate Fluffy_Pillow 898286.1/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:36.006 default M conflagrate Fluffy_Pillow 853039.0/1100000: 78% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:37.218 default L chaos_bolt Fluffy_Pillow 869565.0/1100000: 79% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:38.634 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:39.849 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:40.913 default O incinerate Fluffy_Pillow 982576.1/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:42.433 default L chaos_bolt Fluffy_Pillow 937301.8/1100000: 85% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:44.454 default M conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:45.886 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:46.952 default L chaos_bolt Fluffy_Pillow 1034068.2/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:48.368 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:49.887 default O incinerate Fluffy_Pillow 1034040.9/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:51.408 default O incinerate Fluffy_Pillow 988780.2/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:52.928 default O incinerate Fluffy_Pillow 943505.9/1100000: 86% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:54.449 default M conflagrate Fluffy_Pillow 898245.2/1100000: 82% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:55.665 default O incinerate Fluffy_Pillow 914825.7/1100000: 83% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:56.731 default L chaos_bolt Fluffy_Pillow 863360.9/1100000: 78% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:58.148 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:59.363 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:00.884 default K dimensional_rift Fluffy_Pillow 988807.5/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:02.100 default O incinerate Fluffy_Pillow 1005388.0/1100000: 91% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:03.621 default O incinerate Fluffy_Pillow 960127.3/1100000: 87% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:05.141 default M conflagrate Fluffy_Pillow 914853.0/1100000: 83% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:06.356 default L chaos_bolt Fluffy_Pillow 931419.9/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:07.772 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:08.836 default O incinerate Fluffy_Pillow 1034040.9/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:10.357 default O incinerate Fluffy_Pillow 988780.2/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:11.878 default H service_imp Fluffy_Pillow 943519.5/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:13.092 default O incinerate Fluffy_Pillow 960072.8/1100000: 87% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:14.613 default M conflagrate Fluffy_Pillow 914812.1/1100000: 83% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:15.828 default L chaos_bolt Fluffy_Pillow 931379.0/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:17.243 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:18.457 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:19.523 default O incinerate Fluffy_Pillow 982589.8/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:21.044 default O incinerate Fluffy_Pillow 937329.1/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:22.565 default O incinerate Fluffy_Pillow 892068.4/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:24.087 default M conflagrate Fluffy_Pillow 846821.3/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:25.301 default L chaos_bolt Fluffy_Pillow 863374.6/1100000: 78% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:26.717 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:27.783 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:29.304 default O incinerate Fluffy_Pillow 988807.5/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:30.824 default O incinerate Fluffy_Pillow 943533.1/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:32.343 default L chaos_bolt Fluffy_Pillow 898245.2/1100000: 82% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:34.364 default M conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:35.578 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:36.792 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:37.856 default O incinerate Fluffy_Pillow 982562.5/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:38.920 default O incinerate Fluffy_Pillow 931070.5/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:40.441 default O incinerate Fluffy_Pillow 885809.8/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:41.961 default O incinerate Fluffy_Pillow 840535.4/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:43.480 default M conflagrate Fluffy_Pillow 795247.5/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:44.697 default L chaos_bolt Fluffy_Pillow 811841.6/1100000: 74% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
3:46.113 default K dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
3:47.329 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
3:48.395 default O incinerate Fluffy_Pillow 1034068.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
3:49.917 default O incinerate Fluffy_Pillow 988821.1/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames
3:51.438 default K dimensional_rift Fluffy_Pillow 943560.4/1100000: 86% mana | 2.0/5: 40% soul_shard lord_of_flames
3:52.651 default F conflagrate Fluffy_Pillow 960100.0/1100000: 87% mana | 2.0/5: 40% soul_shard lord_of_flames
3:53.866 default D immolate Fluffy_Pillow 976666.9/1100000: 89% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames
3:55.081 default L chaos_bolt Fluffy_Pillow 927233.8/1100000: 84% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames
3:56.498 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
3:57.565 default K dimensional_rift Fluffy_Pillow 1034081.8/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
3:58.781 default O incinerate Fluffy_Pillow 1050662.3/1100000: 96% mana | 1.0/5: 20% soul_shard lord_of_flames
4:00.302 default O incinerate Fluffy_Pillow 1005401.6/1100000: 91% mana | 1.0/5: 20% soul_shard lord_of_flames
4:01.825 default O incinerate Fluffy_Pillow 960168.2/1100000: 87% mana | 1.0/5: 20% soul_shard lord_of_flames
4:03.345 default F conflagrate Fluffy_Pillow 914893.9/1100000: 83% mana | 1.0/5: 20% soul_shard lord_of_flames
4:04.561 default L chaos_bolt Fluffy_Pillow 931474.4/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
4:05.977 default J summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:07.191 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
4:08.256 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
4:09.776 default N immolate Fluffy_Pillow 988780.2/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames
4:10.991 default O incinerate Fluffy_Pillow 939347.1/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames
4:12.511 default F conflagrate Fluffy_Pillow 894072.8/1100000: 81% mana | 0.0/5: 0% soul_shard lord_of_flames
4:13.727 default L chaos_bolt Fluffy_Pillow 910653.3/1100000: 83% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:15.142 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:16.207 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:17.727 default O incinerate Fluffy_Pillow 988780.2/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:19.247 default O incinerate Fluffy_Pillow 943505.9/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:20.768 default E potion Fluffy_Pillow 898245.2/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:20.768 default O incinerate Fluffy_Pillow 898245.2/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:22.289 default K dimensional_rift Fluffy_Pillow 852984.5/1100000: 78% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:23.501 default M conflagrate Fluffy_Pillow 869510.5/1100000: 79% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:24.717 default L chaos_bolt Fluffy_Pillow 886091.0/1100000: 81% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, potion_of_deadly_grace
4:26.133 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, potion_of_deadly_grace
4:27.199 default K dimensional_rift Fluffy_Pillow 1034068.2/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames, potion_of_deadly_grace
4:28.414 default N immolate Fluffy_Pillow 1050635.1/1100000: 96% mana | 0.0/5: 0% soul_shard lord_of_flames, potion_of_deadly_grace
4:29.629 default O incinerate Fluffy_Pillow 1001202.0/1100000: 91% mana | 0.0/5: 0% soul_shard lord_of_flames, potion_of_deadly_grace
4:31.151 default F conflagrate Fluffy_Pillow 955954.9/1100000: 87% mana | 0.0/5: 0% soul_shard lord_of_flames, potion_of_deadly_grace
4:32.366 default K dimensional_rift Fluffy_Pillow 972521.8/1100000: 88% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:33.581 default O incinerate Fluffy_Pillow 989088.7/1100000: 90% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:34.648 default O incinerate Fluffy_Pillow 937637.6/1100000: 85% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:35.713 default O incinerate Fluffy_Pillow 886159.2/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:37.234 default O incinerate Fluffy_Pillow 840898.5/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:38.755 default O incinerate Fluffy_Pillow 795637.8/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:40.277 default L chaos_bolt Fluffy_Pillow 750390.7/1100000: 68% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:42.297 default M conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
4:43.513 default H service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, potion_of_deadly_grace
4:44.728 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft(2), lord_of_flames, potion_of_deadly_grace
4:45.942 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft(2), lord_of_flames
4:47.008 default O incinerate Fluffy_Pillow 982589.8/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:48.074 default O incinerate Fluffy_Pillow 931125.0/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
4:49.595 default O incinerate Fluffy_Pillow 885864.3/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
4:51.115 default F conflagrate Fluffy_Pillow 840590.0/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames
4:52.328 default L chaos_bolt Fluffy_Pillow 857129.6/1100000: 78% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames
4:53.743 default O incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:54.808 default O incinerate Fluffy_Pillow 1034054.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
4:56.328 default O incinerate Fluffy_Pillow 988780.2/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames
4:57.847 default O incinerate Fluffy_Pillow 943492.2/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames
4:59.368 default O incinerate Fluffy_Pillow 898231.5/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames
5:00.891 default F conflagrate Fluffy_Pillow 852998.1/1100000: 78% mana | 1.0/5: 20% soul_shard lord_of_flames
5:02.105 default L chaos_bolt Fluffy_Pillow 869551.4/1100000: 79% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
5:03.520 default N immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 43516 43516 26460
Intellect 36667 34961 25969 (2654)
Spirit 0 0 0
Health 2610960 2610960 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 36667 34961 0
Crit 17.56% 17.56% 5024
Haste 23.96% 22.94% 8602
Damage / Heal Versatility 5.95% 5.95% 2826
ManaReg per Second 13635 13523 0
Mastery 77.07% 77.07% 7075
Armor 1798 1798 1798
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Celestially Aligned Hood
ilevel: 865, stats: { 223 Armor, +2348 Sta, +1566 Int, +1036 Mastery, +413 Haste }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 910, stats: { +2010 Sta, +1247 Mastery, +1247 Crit, +1247 Haste }, gems: { +150 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 880, stats: { 217 Armor, +2026 Sta, +1351 Int, +673 Mastery, +476 Crit }, gems: { +100 Haste }
Local Chest Seawitch Robes
ilevel: 865, stats: { 274 Armor, +1566 Int, +2349 Sta, +1036 Mastery, +413 Vers }
Local Waist Antiquated Highborne Cinch
ilevel: 870, stats: { 157 Armor, +1846 Sta, +1231 Int, +744 Vers, +364 Haste }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2701 Sta, +1801 Int, +1062 Crit, +470 Haste }
Local Feet Norgannon's Foresight
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +735 Haste, +551 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 880, stats: { 127 Armor, +1519 Sta, +1013 Int, +542 Mastery, +320 Crit }
Local Hands Handwraps of Delusional Power
ilevel: 865, stats: { 172 Armor, +1761 Sta, +1174 Int, +706 Haste, +380 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 865, stats: { +1321 Sta, +1287 Haste, +1083 Mastery }, enchant: { +200 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 875, stats: { +1450 Sta, +1440 Crit, +1080 Vers }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Trinket1 Twisting Wind
ilevel: 865, stats: { +1489 AgiInt }
Local Trinket2 Swarming Plaguehive
ilevel: 885, stats: { +1116 Haste }
Local Back Mantle of the Victorious Dead
ilevel: 895, stats: { 153 Armor, +1165 StrAgiInt, +1747 Sta, +534 Vers, +377 Haste }, gems: { +150 Haste }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 880, weapon: { 4437 - 6658, 3.6 }, stats: { +1801 Int, +2702 Sta, +768 Haste, +768 Mastery, +9826 Int }, relics: { +42 ilevels, +46 ilevels, +42 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Dèmonos"
origin="https://eu.api.battle.net/wow/character/hyjal/Dèmonos/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/26/121914138-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=tailoring=246/enchanting=730
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!0021110
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:4
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=celestially_aligned_hood,id=139188,bonus_id=1805/1487
neck=prydaz_xavarics_magnum_opus,id=132444,bonus_id=1811/3458,gems=150haste,enchant=mark_of_the_hidden_satyr
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1806/1808/1502,gems=100haste
back=mantle_of_the_victorious_dead,id=142540,bonus_id=3468/1808/1512/3337,gems=150haste,enchant=200int
chest=seawitch_robes,id=134263,bonus_id=3474/1527/3337
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3514/1477/3336
hands=handwraps_of_delusional_power,id=138212,bonus_id=1805/1487
waist=antiquated_highborne_cinch,id=140849,bonus_id=3443/1467/1813
legs=leggings_of_the_lower_planes,id=142413,bonus_id=3468/1497/3336
feet=norgannons_foresight,id=132455,bonus_id=1811/3458
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1805/1487,enchant=200haste
finger2=grubby_silver_ring,id=139236,bonus_id=1805/1808/1497/3336,gems=150haste,enchant=200haste
trinket1=twisting_wind,id=139323,bonus_id=1805/1487
trinket2=swarming_plaguehive,id=139321,bonus_id=1806/1507/3336
main_hand=scepter_of_sargeras,id=128941,bonus_id=749,gem_id=143687/142516/133764/0,relic_id=3474:1507:1674/3467:1477/1727:1497:3336/0

# Gear Summary
# gear_ilvl=879.33
# gear_stamina=26460
# gear_intellect=25969
# gear_crit_rating=4925
# gear_haste_rating=8433
# gear_mastery_rating=6936
# gear_versatility_rating=2771
# gear_armor=1798
default_pet=imp

Zuan

Zuan : 544668 dps

  • Race: Human
  • Class: Warrior
  • Spec: Arms
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
544668.1 544668.1 590.9 / 0.108% 117598.1 / 21.6% 48459.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
11.2 11.2 Rage 3.13% 81.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Zuan/advanced
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Defensive Stance (Arms Warrior)
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact
Professions
  • alchemy: 528
  • herbalism: 799

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zuan 544668
auto_attack_mh 29951 5.5% 102.3 2.96sec 87993 30072 Direct 102.3 68846 141176 87994 26.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.27 102.27 0.00 0.00 2.9261 0.0000 8999096.79 13229524.70 31.98 30071.87 30071.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.20 73.53% 68845.56 34857 84176 68867.86 58256 73554 5176913 7610552 31.98
crit 27.07 26.47% 141175.74 69715 168353 141249.44 114110 155062 3822184 5618972 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (3565) 0.0% (0.7%) 2.4 113.25sec 443359 226646

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.42 0.00 7.40 0.00 1.9562 0.5574 0.00 0.00 0.00 226645.97 226645.97
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 3565 0.7% 0.0 0.00sec 0 0 Direct 7.4 131012 262588 144981 10.6%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.40 0.00 0.00 0.0000 0.0000 1073168.68 1577659.61 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.62 89.39% 131012.33 85258 205889 131059.39 0 205889 866818 1274304 31.91
crit 0.79 10.61% 262587.90 170517 411778 144421.72 0 411778 206351 303355 17.63
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Colossus Smash 63881 11.7% 49.9 6.12sec 383953 311773 Direct 49.9 319354 631769 383948 20.7%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.95 49.95 0.00 0.00 1.2315 0.0000 19176872.49 28191819.04 31.98 311773.44 311773.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.62 79.32% 319354.06 162145 391560 318577.13 256561 346357 12652385 18600205 31.98
crit 10.33 20.68% 631768.66 324289 783119 630726.60 379008 764474 6524487 9591614 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown_react&debuff.colossus_smash.remains<gcd
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.65
 
Corrupted Blood of Zakajz 45456 8.3% 0.0 0.00sec 0 0 Periodic 54.6 249785 0 249785 0.0% 36.3%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 54.64 54.64 0.0000 2.0000 13647403.50 13647403.50 0.00 124890.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.6 100.00% 249784.63 17923 495195 250271.08 153166 323721 13647404 13647404 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 73796 13.6% 28.6 2.15sec 775076 602939 Direct 28.6 491752 1069442 775093 49.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.60 28.60 0.00 0.00 1.2855 0.0000 22164042.15 32583241.39 31.98 602939.12 602939.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.57 50.95% 491751.72 58649 736479 492721.45 246633 617929 7164279 10532169 31.98
crit 14.03 49.05% 1069442.18 117298 1472958 1066421.68 513806 1287894 14999763 22051073 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m4 additional Rage to deal up to ${$sw2*$m4/10} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.79
 
Horrific Slam 13005 2.4% 70.8 3.02sec 55240 0 Direct 70.8 43558 88465 55241 26.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.76 70.76 0.00 0.00 0.0000 0.0000 3908987.60 3908987.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.35 73.98% 43558.19 21934 52969 43545.66 21934 52969 2280422 2280422 0.00
crit 18.41 26.02% 88464.78 43869 105938 88168.55 0 105938 1628566 1628566 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17354.25
  • base_dd_max:19181.01
 
Mark of the Hidden Satyr 12543 2.3% 17.4 17.19sec 216044 0 Direct 17.4 170355 347845 216049 25.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.45 17.45 0.00 0.00 0.0000 0.0000 3769393.93 3769393.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.96 74.26% 170355.44 86613 209160 170286.59 113822 201413 2207076 2207076 0.00
crit 4.49 25.74% 347845.48 173226 418319 344528.82 0 418319 1562317 1562317 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mortal Strike 176066 32.4% 67.9 4.40sec 778537 634370 Direct 67.9 485642 1123014 778548 46.0%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.92 67.92 0.00 0.00 1.2273 0.0000 52881744.69 77741173.80 31.98 634370.33 634370.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.71 54.05% 485641.75 129659 773384 485905.19 377077 581902 17829127 26210506 31.98
crit 31.21 45.95% 1123013.74 259318 1546769 1123475.08 915043 1300007 35052617 51530668 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown_react
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals ${$sw3*$<mult>} Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.95
 
Pepper Breath 7404 1.4% 13.9 21.30sec 160346 0 Periodic 69.0 32255 0 32255 0.0% 5.7%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.87 0.00 69.02 68.96 0.0000 0.2497 2224381.67 2224381.67 0.00 129046.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.0 100.00% 32255.38 137 34191 32261.23 22569 34191 2224382 2224382 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Potion of the Old War 33511 6.1% 24.4 5.50sec 406189 0 Direct 24.4 304235 648385 406192 29.6%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.40 24.40 0.00 0.00 0.0000 0.0000 9910657.51 14569605.30 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.17 70.38% 304235.35 138766 335104 303999.43 208740 332165 5224037 7679830 31.98
crit 7.23 29.62% 648384.88 277533 670209 649332.62 445429 670209 4686620 6889776 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Wave 16336 3.0% 13.4 19.13sec 365256 0 Direct 13.4 284360 581771 365256 27.2%  

Stats details: shadow_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.43 13.43 0.00 0.00 0.0000 0.0000 4906167.63 4906167.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.78 72.80% 284359.77 143708 347037 284111.67 0 347037 2780466 2780466 0.00
crit 3.65 27.20% 581771.46 287415 694073 553857.85 0 694073 2125702 2125702 0.00
 
 

Action details: shadow_wave

Static Values
  • id:215047
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215047
  • name:Shadow Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215089=Your melee attacks have a chance to unleash 4 Shadow Waves that deal {$s1=78543} Shadow damage to enemies in their path. The waves travel 15 yards away from you, and then return.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119686.12
  • base_dd_max:119686.12
 
Slam 63815 11.7% 81.6 2.89sec 235179 192268 Direct 81.6 182005 361984 235181 29.5%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.57 81.57 0.00 0.00 1.2232 0.0000 19183381.76 28201388.29 31.98 192268.34 192268.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.47 70.45% 182005.44 89614 216406 182165.82 159811 197221 10459763 15376842 31.98
crit 24.10 29.55% 361984.33 179227 432813 362602.34 266541 408767 8723619 12824547 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.whirlwind=1&!talent.fervor_of_battle.enabled
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.73
 
Warbreaker 5341 1.0% 4.0 73.19sec 398750 322709 Direct 4.0 318098 673829 398743 22.7%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.03 4.03 0.00 0.00 1.2357 0.0000 1606444.48 1606444.48 0.00 322708.81 322708.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.12 77.33% 318097.64 168959 408016 316982.15 0 408016 990904 990904 0.00
crit 0.91 22.67% 673828.89 337918 816031 429506.22 0 816031 615540 615540 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.remains<gcd
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Zuan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
Avatar 3.8 90.29sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:gcd.remains<0.25&(buff.battle_cry.up|cooldown.battle_cry.remains<15)|target.time_to_die<=20
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 10.6 29.86sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:gcd.remains<0.25&cooldown.avatar.remains>=10&(buff.shattered_defenses.up|cooldown.warbreaker.remains>7&cooldown.colossus_smash.remains>7|cooldown.colossus_smash.remains&debuff.colossus_smash.remains>gcd)|!cooldown.colossus_smash.remains<gcd|target.time_to_die<=7
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, reducing its movement speed by {$236027s1=50}% for {$236027d=6 seconds}{$?s103828=false}[, and stunning it for {$7922d=0 milliseconds}][]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
Focused Rage 151.1 1.94sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 151.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
Heroic Leap 7.0 46.08sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.colossus_smash.down|debuff.colossus_smash.remains<2)&cooldown.colossus_smash.remains&equipped.weight_of_the_earth|!equipped.weight_of_the_earth&debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 3.8 0.0 91.1sec 90.3sec 24.27% 24.27% 0.0(0.0) 3.6

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:24.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 10.6 0.0 29.9sec 29.9sec 17.44% 17.44% 0.0(0.0) 10.4

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:17.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 2.4 0.0 112.9sec 112.9sec 1.37% 1.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:1.37%

Trigger Attempt Success

  • trigger_pct:99.80%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 10.6 0.0 29.9sec 29.9sec 17.44% 18.31% 0.0(0.0) 10.4

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:17.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 63.3 87.8 4.6sec 1.9sec 67.51% 92.38% 3.9(3.9) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:34.93%
  • focused_rage_2:18.96%
  • focused_rage_3:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
Horrific Appendages 4.0 0.7 65.2sec 52.5sec 17.88% 17.88% 71.5(71.5) 3.8

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:17.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 100.9sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 54.0 0.0 5.6sec 5.6sec 32.04% 32.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.60

Stack Uptimes

  • precise_strikes_1:32.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shattered Defenses 54.0 0.0 5.6sec 5.6sec 32.04% 55.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:32.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
tactician 55.2 5.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry2.4220.00119.17010.7420.00031.533
Avatar1.7420.00115.5633.0270.00026.711
Heroic Leap1.6580.00124.5516.3770.00051.814
Focused Rage1.8200.00138.116107.45955.465170.034
Colossus Smash1.4550.0017.72571.07732.481123.895
Warbreaker15.2800.001159.53240.8790.000171.255
Mortal Strike1.3020.00112.86085.86835.909141.863
Bladestorm25.4400.001214.70732.5580.000214.707

Resources

Resource Usage Type Count Total Average RPE APR
Zuan
execute Rage 28.6 529.4 18.5 18.5 41867.9
focused_rage Rage 151.1 1304.3 8.6 8.6 0.0
mortal_strike Rage 67.9 511.8 7.5 7.5 103324.0
slam Rage 81.6 1027.5 12.6 12.6 18669.2
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 25.00 (0.73%) 25.00 0.00 0.00%
archavons_heavy_hand Rage 67.93 540.18 (15.76%) 7.95 3.22 0.59%
melee_crit Rage 27.07 983.20 (28.68%) 36.32 15.91 1.59%
melee_main_hand Rage 75.20 1879.96 (54.84%) 25.00 14.99 0.79%
Resource RPS-Gain RPS-Loss
Rage 11.40 11.21
Combat End Resource Mean Min Max
Rage 56.34 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 1.0%

Statistics & Data Analysis

Fight Length
Sample Data Zuan Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Zuan Damage Per Second
Count 9999
Mean 544668.15
Minimum 444080.63
Maximum 697928.55
Spread ( max - min ) 253847.92
Range [ ( max - min ) / 2 * 100% ] 23.30%
Standard Deviation 30148.2736
5th Percentile 495538.75
95th Percentile 594915.43
( 95th Percentile - 5th Percentile ) 99376.68
Mean Distribution
Standard Deviation 301.4978
95.00% Confidence Intervall ( 544077.22 - 545259.07 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11770
0.1 Scale Factor Error with Delta=300 7759051
0.05 Scale Factor Error with Delta=300 31036201
0.01 Scale Factor Error with Delta=300 775905025
Priority Target DPS
Sample Data Zuan Priority Target Damage Per Second
Count 9999
Mean 544668.15
Minimum 444080.63
Maximum 697928.55
Spread ( max - min ) 253847.92
Range [ ( max - min ) / 2 * 100% ] 23.30%
Standard Deviation 30148.2736
5th Percentile 495538.75
95th Percentile 594915.43
( 95th Percentile - 5th Percentile ) 99376.68
Mean Distribution
Standard Deviation 301.4978
95.00% Confidence Intervall ( 544077.22 - 545259.07 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11770
0.1 Scale Factor Error with Delta=300 7759051
0.05 Scale Factor Error with Delta=300 31036201
0.01 Scale Factor Error with Delta=300 775905025
DPS(e)
Sample Data Zuan Damage Per Second (Effective)
Count 9999
Mean 544668.15
Minimum 444080.63
Maximum 697928.55
Spread ( max - min ) 253847.92
Range [ ( max - min ) / 2 * 100% ] 23.30%
Damage
Sample Data Zuan Damage
Count 9999
Mean 163451742.87
Minimum 112681828.12
Maximum 217960480.58
Spread ( max - min ) 105278652.46
Range [ ( max - min ) / 2 * 100% ] 32.20%
DTPS
Sample Data Zuan Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zuan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zuan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zuan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zuan Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zuan Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZuanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zuan Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 1.00 potion,name=old_war,if=buff.avatar.up&buff.battle_cry.up&debuff.colossus_smash.up|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
0.00 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40&cooldown.battle_cry.remains
8 10.57 battle_cry,if=gcd.remains<0.25&cooldown.avatar.remains>=10&(buff.shattered_defenses.up|cooldown.warbreaker.remains>7&cooldown.colossus_smash.remains>7|cooldown.colossus_smash.remains&debuff.colossus_smash.remains>gcd)|!cooldown.colossus_smash.remains<gcd|target.time_to_die<=7
9 3.76 avatar,if=gcd.remains<0.25&(buff.battle_cry.up|cooldown.battle_cry.remains<15)|target.time_to_die<=20
0.00 use_item,name=draught_of_souls,if=equipped.draught_of_souls&((prev_gcd.1.mortal_strike|cooldown.mortal_strike.remains>=3)&buff.battle_cry.remains>=3&debuff.colossus_smash.up&buff.avatar.remains>=3)
0.00 use_item,name=kiljaedens_burning_wish,if=equipped.kiljaedens_burning_wish&debuff.colossus_smash.up
A 7.02 heroic_leap,if=(debuff.colossus_smash.down|debuff.colossus_smash.remains<2)&cooldown.colossus_smash.remains&equipped.weight_of_the_earth|!equipped.weight_of_the_earth&debuff.colossus_smash.up
0.00 rend,if=remains<gcd
B 42.41 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
C 11.05 colossus_smash,if=cooldown_react&debuff.colossus_smash.remains<gcd
D 4.03 warbreaker,if=debuff.colossus_smash.remains<gcd
0.00 ravager
0.00 overpower,if=buff.overpower.react
E 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
F 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=5&!talent.sweeping_strikes.enabled
G 0.00 run_action_list,name=execute,target_if=target.health.pct<=20&spell_targets.whirlwind<5
H 0.00 run_action_list,name=single,if=target.health.pct>20
actions.execute
# count action,conditions
I 1.95 mortal_strike,if=cooldown_react&buff.battle_cry.up&buff.focused_rage.stack=3
J 5.08 execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.
K 8.08 colossus_smash,if=cooldown_react&buff.shattered_defenses.down
L 9.73 execute,if=buff.shattered_defenses.up&(rage>=17.6|buff.stone_heart.react)
M 4.79 mortal_strike,if=cooldown_react&equipped.archavons_heavy_hand&rage<60|talent.in_for_the_kill.enabled&buff.shattered_defenses.down
N 13.78 execute,if=buff.shattered_defenses.down
O 0.37 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single
# count action,conditions
P 30.82 colossus_smash,if=cooldown_react&buff.shattered_defenses.down&(buff.battle_cry.down|buff.battle_cry.up&buff.battle_cry.remains>=gcd|buff.corrupted_blood_of_zakajz.remains>=gcd)
Q 108.69 focused_rage,if=!buff.battle_cry_deadly_calm.up&buff.focused_rage.stack<3&!cooldown.colossus_smash.up&(rage>=50|debuff.colossus_smash.down|cooldown.battle_cry.remains<=8)|cooldown.battle_cry.remains<=8&cooldown.battle_cry.remains>0&rage>100
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)&buff.battle_cry.down #Remove the # above to run out of melee and charge back in for rage.
R 61.19 mortal_strike,if=cooldown.battle_cry.remains>8|!buff.battle_cry.remains>(gcd.max*2)&buff.focused_rage.stack<3|buff.battle_cry.remains<=gcd
0.00 execute,if=buff.stone_heart.react
0.00 whirlwind,if=spell_targets.whirlwind>1|talent.fervor_of_battle.enabled
S 81.57 slam,if=spell_targets.whirlwind=1&!talent.fervor_of_battle.enabled
T 2.05 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

Sample Sequence

024569CQ8BARBPBRBSBRPQQSQSRPQQSQRPQQRPQQSQSRQSSSRQQDQS8BSRBBPBSBSRQQSQRPQQRPQRPQQSRPQRPQQRPQQASQSRQPQQR8BSBSBSBRCQQRQSQSQSRQQSQSTRCQRSQPRQSQSPQRQQSQRCQQS98B7ARBPBRBSQSQSRQDSQSRPQRPQRPQQSSQRSQSQQ8RBSBSBCRQQRPQQSQRPQRPQQSARPQSQRPQSSRPQQRQ8SBRBPBSQSRPQQSQSRPQRPQQSQRPQQSQSRQSQTDQRQQSQ98SBASBRBSQRCQQSQRPQQSSRSQSSQQRQCRSQQSPQ8RBBSBSBSRQQSQSSRQCRQSSSARQSQRCRQSQS8BSDRBBSQSNKLMNNNCLNMKMNNNKOL98BJBAJBCIBNKLNKLNMNKLMNNMNN8BBDBIBJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Zuan 0.0/130: 0% rage
Pre precombat 2 augmentation Zuan 0.0/130: 0% rage
Pre precombat 4 potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 default 5 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 default 6 auto_attack Fluffy_Pillow 25.0/130: 19% rage bloodlust, potion_of_the_old_war
0:00.000 default 9 avatar Fluffy_Pillow 50.2/130: 39% rage bloodlust, potion_of_the_old_war
0:00.000 default C colossus_smash Fluffy_Pillow 50.2/130: 39% rage bloodlust, avatar, potion_of_the_old_war
0:00.000 single Q focused_rage Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:00.800 default 8 battle_cry Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:00.985 default B focused_rage Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:00.990 default A heroic_leap Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:00.990 single R mortal_strike Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:01.970 default B focused_rage Fluffy_Pillow 46.2/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:01.980 single P colossus_smash Fluffy_Pillow 46.2/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:02.955 default B focused_rage Fluffy_Pillow 82.5/130: 63% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:02.969 single R mortal_strike Fluffy_Pillow 82.5/130: 63% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:03.940 default B focused_rage Fluffy_Pillow 90.5/130: 70% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.958 single S slam Fluffy_Pillow 90.5/130: 70% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:04.925 default B focused_rage Fluffy_Pillow 127.3/130: 98% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:04.947 single R mortal_strike Fluffy_Pillow 127.3/130: 98% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:05.938 single P colossus_smash Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, potion_of_the_old_war
0:05.938 single Q focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:06.923 single Q focused_rage Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:06.927 single S slam Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:07.908 single Q focused_rage Fluffy_Pillow 103.2/130: 79% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:07.915 single S slam Fluffy_Pillow 103.2/130: 79% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:08.904 single R mortal_strike Fluffy_Pillow 87.2/130: 67% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:09.893 single P colossus_smash Fluffy_Pillow 114.0/130: 88% rage bloodlust, avatar, potion_of_the_old_war
0:09.893 single Q focused_rage Fluffy_Pillow 102.0/130: 78% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:10.878 single Q focused_rage Fluffy_Pillow 90.0/130: 69% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:10.882 single S slam Fluffy_Pillow 90.0/130: 69% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:11.863 single Q focused_rage Fluffy_Pillow 87.2/130: 67% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:11.869 single R mortal_strike Fluffy_Pillow 87.2/130: 67% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:12.859 single P colossus_smash Fluffy_Pillow 88.8/130: 68% rage bloodlust, avatar, potion_of_the_old_war
0:12.859 single Q focused_rage Fluffy_Pillow 76.8/130: 59% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:13.844 single Q focused_rage Fluffy_Pillow 64.8/130: 50% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:13.846 single R mortal_strike Fluffy_Pillow 64.8/130: 50% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:14.834 single P colossus_smash Fluffy_Pillow 91.6/130: 70% rage bloodlust, avatar, potion_of_the_old_war
0:14.834 single Q focused_rage Fluffy_Pillow 79.6/130: 61% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:15.819 single Q focused_rage Fluffy_Pillow 67.6/130: 52% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:15.823 single S slam Fluffy_Pillow 67.6/130: 52% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:16.804 single Q focused_rage Fluffy_Pillow 64.8/130: 50% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:16.815 single S slam Fluffy_Pillow 64.8/130: 50% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:17.803 single R mortal_strike Fluffy_Pillow 48.8/130: 38% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:17.803 single Q focused_rage Fluffy_Pillow 38.4/130: 30% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:18.793 single S slam Fluffy_Pillow 38.4/130: 30% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:19.780 single S slam Fluffy_Pillow 47.6/130: 37% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:20.771 single S slam Fluffy_Pillow 31.6/130: 24% rage bloodlust, focused_rage, potion_of_the_old_war
0:21.759 single R mortal_strike Fluffy_Pillow 40.8/130: 31% rage bloodlust, focused_rage, potion_of_the_old_war
0:21.759 single Q focused_rage Fluffy_Pillow 20.8/130: 16% rage bloodlust, focused_rage, potion_of_the_old_war
0:22.744 single Q focused_rage Fluffy_Pillow 8.8/130: 7% rage bloodlust, focused_rage(2), potion_of_the_old_war
0:22.748 default D warbreaker Fluffy_Pillow 8.8/130: 7% rage bloodlust, focused_rage(2), potion_of_the_old_war
0:23.736 single Q focused_rage Fluffy_Pillow 34.0/130: 26% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:23.736 single S slam Fluffy_Pillow 22.0/130: 17% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:24.536 default 8 battle_cry Fluffy_Pillow 6.0/130: 5% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:24.721 default B focused_rage Fluffy_Pillow 6.0/130: 5% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:24.727 single S slam Fluffy_Pillow 6.0/130: 5% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:25.716 single R mortal_strike Fluffy_Pillow 6.0/130: 5% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:25.716 default B focused_rage Fluffy_Pillow 14.0/130: 11% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:26.701 default B focused_rage Fluffy_Pillow 50.0/130: 38% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:26.705 single P colossus_smash Fluffy_Pillow 50.0/130: 38% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:27.686 default B focused_rage Fluffy_Pillow 50.0/130: 38% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:27.695 single S slam Fluffy_Pillow 50.0/130: 38% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:28.671 default B focused_rage Fluffy_Pillow 87.0/130: 67% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:28.684 single S slam Fluffy_Pillow 87.0/130: 67% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:29.674 single R mortal_strike Fluffy_Pillow 87.0/130: 67% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:29.674 single Q focused_rage Fluffy_Pillow 76.6/130: 59% rage bloodlust, focused_rage
0:30.659 single Q focused_rage Fluffy_Pillow 64.6/130: 50% rage bloodlust, focused_rage(2)
0:30.662 single S slam Fluffy_Pillow 64.6/130: 50% rage bloodlust, focused_rage(2)
0:31.644 single Q focused_rage Fluffy_Pillow 61.8/130: 48% rage bloodlust, focused_rage(3)
0:31.651 single R mortal_strike Fluffy_Pillow 61.8/130: 48% rage bloodlust, focused_rage(3)
0:32.640 single P colossus_smash Fluffy_Pillow 53.8/130: 41% rage bloodlust
0:32.640 single Q focused_rage Fluffy_Pillow 41.8/130: 32% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:33.625 single Q focused_rage Fluffy_Pillow 55.0/130: 42% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:33.630 single R mortal_strike Fluffy_Pillow 55.0/130: 42% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:34.619 single P colossus_smash Fluffy_Pillow 56.6/130: 44% rage bloodlust
0:34.619 single Q focused_rage Fluffy_Pillow 44.6/130: 34% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:35.609 single R mortal_strike Fluffy_Pillow 69.8/130: 54% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:36.600 single P colossus_smash Fluffy_Pillow 71.4/130: 55% rage bloodlust
0:36.600 single Q focused_rage Fluffy_Pillow 59.4/130: 46% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:37.585 single Q focused_rage Fluffy_Pillow 47.4/130: 36% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:37.591 single S slam Fluffy_Pillow 47.4/130: 36% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:38.581 single R mortal_strike Fluffy_Pillow 56.6/130: 44% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:39.570 single P colossus_smash Fluffy_Pillow 58.2/130: 45% rage bloodlust
0:39.570 single Q focused_rage Fluffy_Pillow 46.2/130: 36% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:40.726 single R mortal_strike Fluffy_Pillow 71.4/130: 55% rage focused_rage, precise_strikes, shattered_defenses
0:42.013 single P colossus_smash Fluffy_Pillow 73.0/130: 56% rage
0:42.013 single Q focused_rage Fluffy_Pillow 61.0/130: 47% rage focused_rage, precise_strikes, shattered_defenses
0:43.294 single Q focused_rage Fluffy_Pillow 49.0/130: 38% rage focused_rage(2), precise_strikes, shattered_defenses
0:43.300 single R mortal_strike Fluffy_Pillow 49.0/130: 38% rage focused_rage(2), precise_strikes, shattered_defenses
0:44.585 single P colossus_smash Fluffy_Pillow 75.8/130: 58% rage
0:44.585 single Q focused_rage Fluffy_Pillow 63.8/130: 49% rage focused_rage, precise_strikes, shattered_defenses
0:45.866 single Q focused_rage Fluffy_Pillow 51.8/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses
0:45.871 default A heroic_leap Fluffy_Pillow 51.8/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses
0:45.990 single S slam Fluffy_Pillow 51.8/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses
0:47.147 single Q focused_rage Fluffy_Pillow 49.0/130: 38% rage focused_rage(3), precise_strikes, shattered_defenses
0:47.276 single S slam Fluffy_Pillow 49.0/130: 38% rage focused_rage(3), precise_strikes, shattered_defenses
0:48.561 single R mortal_strike Fluffy_Pillow 33.0/130: 25% rage focused_rage(3), precise_strikes, shattered_defenses
0:48.561 single Q focused_rage Fluffy_Pillow 22.6/130: 17% rage focused_rage
0:49.845 single P colossus_smash Fluffy_Pillow 47.8/130: 37% rage focused_rage
0:49.845 single Q focused_rage Fluffy_Pillow 35.8/130: 28% rage focused_rage(2), precise_strikes, shattered_defenses
0:51.126 single Q focused_rage Fluffy_Pillow 23.8/130: 18% rage focused_rage(3), precise_strikes, shattered_defenses
0:51.128 single R mortal_strike Fluffy_Pillow 23.8/130: 18% rage focused_rage(3), precise_strikes, shattered_defenses
0:52.228 default 8 battle_cry Fluffy_Pillow 25.4/130: 20% rage corrupted_blood_of_zakajz, battle_cry
0:52.407 default B focused_rage Fluffy_Pillow 25.4/130: 20% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:52.414 single S slam Fluffy_Pillow 25.4/130: 20% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:53.688 default B focused_rage Fluffy_Pillow 62.3/130: 48% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:53.698 single S slam Fluffy_Pillow 62.3/130: 48% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:54.969 default B focused_rage Fluffy_Pillow 62.3/130: 48% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
0:54.984 single S slam Fluffy_Pillow 62.3/130: 48% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
0:56.250 default B focused_rage Fluffy_Pillow 100.0/130: 77% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
0:56.271 single R mortal_strike Fluffy_Pillow 100.0/130: 77% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
0:57.556 default C colossus_smash Fluffy_Pillow 108.0/130: 83% rage horrific_appendages
0:57.556 single Q focused_rage Fluffy_Pillow 96.0/130: 74% rage focused_rage, precise_strikes, shattered_defenses, horrific_appendages
0:58.837 single Q focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
0:58.845 single R mortal_strike Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:00.118 single Q focused_rage Fluffy_Pillow 107.6/130: 83% rage focused_rage, horrific_appendages
1:00.131 single S slam Fluffy_Pillow 107.6/130: 83% rage focused_rage, horrific_appendages
1:01.399 single Q focused_rage Fluffy_Pillow 79.6/130: 61% rage focused_rage(2), horrific_appendages
1:01.415 single S slam Fluffy_Pillow 79.6/130: 61% rage focused_rage(2), horrific_appendages
1:02.680 single Q focused_rage Fluffy_Pillow 76.8/130: 59% rage focused_rage(3), horrific_appendages
1:02.699 single S slam Fluffy_Pillow 76.8/130: 59% rage focused_rage(3), horrific_appendages
1:03.986 single R mortal_strike Fluffy_Pillow 60.8/130: 47% rage focused_rage(3), horrific_appendages
1:03.986 single Q focused_rage Fluffy_Pillow 40.8/130: 31% rage focused_rage, horrific_appendages
1:05.267 single Q focused_rage Fluffy_Pillow 54.0/130: 42% rage focused_rage(2), horrific_appendages
1:05.271 single S slam Fluffy_Pillow 54.0/130: 42% rage focused_rage(2), horrific_appendages
1:06.548 single Q focused_rage Fluffy_Pillow 26.0/130: 20% rage focused_rage(3), horrific_appendages
1:06.555 single S slam Fluffy_Pillow 26.0/130: 20% rage focused_rage(3), horrific_appendages
1:07.840 single T bladestorm Fluffy_Pillow 10.0/130: 8% rage focused_rage(3)
1:09.761 single R mortal_strike Fluffy_Pillow 35.2/130: 27% rage focused_rage(3)
1:11.048 default C colossus_smash Fluffy_Pillow 52.4/130: 40% rage
1:11.048 single Q focused_rage Fluffy_Pillow 40.4/130: 31% rage focused_rage, precise_strikes, shattered_defenses
1:12.334 single R mortal_strike Fluffy_Pillow 40.4/130: 31% rage focused_rage, precise_strikes, shattered_defenses
1:13.618 single S slam Fluffy_Pillow 42.0/130: 32% rage
1:14.118 single Q focused_rage Fluffy_Pillow 39.2/130: 30% rage focused_rage
1:14.904 single P colossus_smash Fluffy_Pillow 39.2/130: 30% rage focused_rage
1:16.189 single R mortal_strike Fluffy_Pillow 39.2/130: 30% rage focused_rage, precise_strikes, shattered_defenses
1:17.189 single Q focused_rage Fluffy_Pillow 54.0/130: 42% rage focused_rage
1:17.473 single S slam Fluffy_Pillow 54.0/130: 42% rage focused_rage
1:18.470 single Q focused_rage Fluffy_Pillow 26.0/130: 20% rage focused_rage(2)
1:18.758 single S slam Fluffy_Pillow 26.0/130: 20% rage focused_rage(2)
1:20.043 single P colossus_smash Fluffy_Pillow 10.0/130: 8% rage focused_rage(2)
1:20.243 single Q focused_rage Fluffy_Pillow 23.2/130: 18% rage focused_rage(3), precise_strikes, shattered_defenses
1:21.329 single R mortal_strike Fluffy_Pillow 23.2/130: 18% rage focused_rage(3), precise_strikes, shattered_defenses
1:21.524 single Q focused_rage Fluffy_Pillow 12.8/130: 10% rage focused_rage
1:22.615 single Q focused_rage Fluffy_Pillow 12.8/130: 10% rage focused_rage
1:22.805 Waiting     0.500 sec 0.8/130: 1% rage focused_rage(2)
1:23.305 single S slam Fluffy_Pillow 26.0/130: 20% rage focused_rage(2)
1:24.589 Waiting     1.800 sec 10.0/130: 8% rage focused_rage(2)
1:26.389 single Q focused_rage Fluffy_Pillow 35.2/130: 27% rage focused_rage(2)
1:26.389 single R mortal_strike Fluffy_Pillow 23.2/130: 18% rage focused_rage(3)
1:27.675 default C colossus_smash Fluffy_Pillow 15.2/130: 12% rage
1:27.675 single Q focused_rage Fluffy_Pillow 3.2/130: 2% rage focused_rage, precise_strikes, shattered_defenses
1:28.960 Waiting     0.500 sec 3.2/130: 2% rage focused_rage, precise_strikes, shattered_defenses
1:29.460 single Q focused_rage Fluffy_Pillow 28.4/130: 22% rage focused_rage, precise_strikes, shattered_defenses
1:29.460 single S slam Fluffy_Pillow 16.4/130: 13% rage focused_rage(2), precise_strikes, shattered_defenses
1:30.560 default 9 avatar Fluffy_Pillow 0.4/130: 0% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:30.660 default 8 battle_cry Fluffy_Pillow 0.4/130: 0% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:30.741 default B focused_rage Fluffy_Pillow 0.4/130: 0% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:30.745 default 7 potion Fluffy_Pillow 0.4/130: 0% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:30.745 default A heroic_leap Fluffy_Pillow 0.4/130: 0% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
1:30.990 single R mortal_strike Fluffy_Pillow 0.4/130: 0% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
1:32.022 default B focused_rage Fluffy_Pillow 8.4/130: 6% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
1:32.277 single P colossus_smash Fluffy_Pillow 8.4/130: 6% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
1:33.303 default B focused_rage Fluffy_Pillow 44.5/130: 34% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
1:33.562 single R mortal_strike Fluffy_Pillow 44.5/130: 34% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
1:34.584 default B focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
1:34.847 single S slam Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
1:35.865 single Q focused_rage Fluffy_Pillow 76.9/130: 59% rage avatar, focused_rage(2), potion_of_the_old_war
1:36.132 single S slam Fluffy_Pillow 76.9/130: 59% rage avatar, focused_rage(2), potion_of_the_old_war
1:37.146 single Q focused_rage Fluffy_Pillow 48.9/130: 38% rage avatar, focused_rage(3), potion_of_the_old_war
1:37.419 single S slam Fluffy_Pillow 48.9/130: 38% rage avatar, focused_rage(3), potion_of_the_old_war
1:38.704 single R mortal_strike Fluffy_Pillow 58.1/130: 45% rage avatar, focused_rage(3), potion_of_the_old_war
1:38.704 single Q focused_rage Fluffy_Pillow 38.1/130: 29% rage avatar, focused_rage, potion_of_the_old_war
1:39.989 default D warbreaker Fluffy_Pillow 38.1/130: 29% rage avatar, focused_rage, potion_of_the_old_war
1:41.274 single S slam Fluffy_Pillow 38.1/130: 29% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
1:41.774 single Q focused_rage Fluffy_Pillow 47.1/130: 36% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
1:42.558 single S slam Fluffy_Pillow 47.1/130: 36% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
1:43.843 single R mortal_strike Fluffy_Pillow 31.1/130: 24% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
1:45.129 single P colossus_smash Fluffy_Pillow 57.9/130: 45% rage avatar, potion_of_the_old_war
1:45.129 single Q focused_rage Fluffy_Pillow 45.9/130: 35% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
1:46.415 single R mortal_strike Fluffy_Pillow 45.9/130: 35% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
1:47.701 single P colossus_smash Fluffy_Pillow 47.5/130: 37% rage avatar, potion_of_the_old_war
1:47.901 single Q focused_rage Fluffy_Pillow 60.7/130: 47% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
1:48.989 single R mortal_strike Fluffy_Pillow 60.7/130: 47% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
1:50.277 single P colossus_smash Fluffy_Pillow 62.3/130: 48% rage avatar, potion_of_the_old_war
1:50.277 single Q focused_rage Fluffy_Pillow 50.3/130: 39% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
1:51.558 single Q focused_rage Fluffy_Pillow 63.5/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
1:51.562 single S slam Fluffy_Pillow 63.5/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
1:52.848 single S slam Fluffy_Pillow 47.5/130: 37% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
1:54.048 single Q focused_rage Fluffy_Pillow 44.7/130: 34% rage focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
1:54.133 single R mortal_strike Fluffy_Pillow 44.7/130: 34% rage focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
1:55.420 single S slam Fluffy_Pillow 46.3/130: 36% rage potion_of_the_old_war
1:56.520 single Q focused_rage Fluffy_Pillow 18.3/130: 14% rage focused_rage
1:56.706 single S slam Fluffy_Pillow 18.3/130: 14% rage focused_rage
1:57.801 single Q focused_rage Fluffy_Pillow 15.5/130: 12% rage focused_rage(2)
1:57.990 Waiting     0.900 sec 15.5/130: 12% rage focused_rage(2)
1:58.890 single Q focused_rage Fluffy_Pillow 15.5/130: 12% rage focused_rage(2)
1:59.082 default 8 battle_cry Fluffy_Pillow 3.5/130: 3% rage focused_rage(3)
1:59.300 single R mortal_strike Fluffy_Pillow 3.5/130: 3% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:00.363 default B focused_rage Fluffy_Pillow 48.7/130: 37% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:00.584 single S slam Fluffy_Pillow 48.7/130: 37% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:01.644 default B focused_rage Fluffy_Pillow 48.7/130: 37% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:01.868 single S slam Fluffy_Pillow 48.7/130: 37% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:02.925 default B focused_rage Fluffy_Pillow 48.7/130: 37% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:03.155 default C colossus_smash Fluffy_Pillow 48.7/130: 37% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:04.441 single R mortal_strike Fluffy_Pillow 85.1/130: 65% rage focused_rage(3), precise_strikes, shattered_defenses
2:04.441 single Q focused_rage Fluffy_Pillow 74.7/130: 57% rage focused_rage
2:05.722 single Q focused_rage Fluffy_Pillow 62.7/130: 48% rage focused_rage(2)
2:05.726 single R mortal_strike Fluffy_Pillow 62.7/130: 48% rage focused_rage(2)
2:07.012 single P colossus_smash Fluffy_Pillow 79.9/130: 61% rage
2:07.012 single Q focused_rage Fluffy_Pillow 67.9/130: 52% rage focused_rage, precise_strikes, shattered_defenses
2:08.293 single Q focused_rage Fluffy_Pillow 55.9/130: 43% rage focused_rage(2), precise_strikes, shattered_defenses
2:08.299 single S slam Fluffy_Pillow 55.9/130: 43% rage focused_rage(2), precise_strikes, shattered_defenses
2:09.574 single Q focused_rage Fluffy_Pillow 53.1/130: 41% rage focused_rage(3), precise_strikes, shattered_defenses
2:09.585 single R mortal_strike Fluffy_Pillow 53.1/130: 41% rage focused_rage(3), precise_strikes, shattered_defenses
2:10.870 single P colossus_smash Fluffy_Pillow 54.7/130: 42% rage
2:10.870 single Q focused_rage Fluffy_Pillow 42.7/130: 33% rage focused_rage, precise_strikes, shattered_defenses
2:12.154 single R mortal_strike Fluffy_Pillow 42.7/130: 33% rage focused_rage, precise_strikes, shattered_defenses
2:13.439 single P colossus_smash Fluffy_Pillow 69.5/130: 53% rage
2:13.439 single Q focused_rage Fluffy_Pillow 57.5/130: 44% rage focused_rage, precise_strikes, shattered_defenses
2:14.720 single Q focused_rage Fluffy_Pillow 45.5/130: 35% rage focused_rage(2), precise_strikes, shattered_defenses
2:14.725 single S slam Fluffy_Pillow 45.5/130: 35% rage focused_rage(2), precise_strikes, shattered_defenses
2:16.010 default A heroic_leap Fluffy_Pillow 54.7/130: 42% rage focused_rage(2), precise_strikes, shattered_defenses
2:16.010 single R mortal_strike Fluffy_Pillow 54.7/130: 42% rage focused_rage(2), precise_strikes, shattered_defenses
2:17.294 single P colossus_smash Fluffy_Pillow 56.3/130: 43% rage
2:17.294 single Q focused_rage Fluffy_Pillow 44.3/130: 34% rage focused_rage, precise_strikes, shattered_defenses
2:18.581 single S slam Fluffy_Pillow 44.3/130: 34% rage focused_rage, precise_strikes, shattered_defenses
2:18.681 single Q focused_rage Fluffy_Pillow 41.5/130: 32% rage focused_rage(2), precise_strikes, shattered_defenses
2:19.868 single R mortal_strike Fluffy_Pillow 41.5/130: 32% rage focused_rage(2), precise_strikes, shattered_defenses
2:21.154 single P colossus_smash Fluffy_Pillow 43.1/130: 33% rage
2:21.754 single Q focused_rage Fluffy_Pillow 56.3/130: 43% rage focused_rage, precise_strikes, shattered_defenses
2:22.441 single S slam Fluffy_Pillow 56.3/130: 43% rage focused_rage, precise_strikes, shattered_defenses
2:23.727 single S slam Fluffy_Pillow 40.3/130: 31% rage focused_rage, precise_strikes, shattered_defenses
2:25.012 single R mortal_strike Fluffy_Pillow 49.5/130: 38% rage focused_rage, precise_strikes, shattered_defenses
2:26.297 single P colossus_smash Fluffy_Pillow 51.1/130: 39% rage
2:26.297 single Q focused_rage Fluffy_Pillow 39.1/130: 30% rage focused_rage, precise_strikes, shattered_defenses
2:27.578 single Q focused_rage Fluffy_Pillow 27.1/130: 21% rage focused_rage(2), precise_strikes, shattered_defenses
2:27.584 single R mortal_strike Fluffy_Pillow 27.1/130: 21% rage focused_rage(2), precise_strikes, shattered_defenses
2:28.859 single Q focused_rage Fluffy_Pillow 41.9/130: 32% rage focused_rage
2:28.869 default 8 battle_cry Fluffy_Pillow 41.9/130: 32% rage focused_rage
2:28.869 single S slam Fluffy_Pillow 41.9/130: 32% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:30.140 default B focused_rage Fluffy_Pillow 41.9/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:30.156 single R mortal_strike Fluffy_Pillow 41.9/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:31.421 default B focused_rage Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:31.442 single P colossus_smash Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:32.702 default B focused_rage Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:32.727 single S slam Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:33.983 single Q focused_rage Fluffy_Pillow 75.6/130: 58% rage focused_rage(3), precise_strikes, shattered_defenses
2:34.012 single S slam Fluffy_Pillow 112.6/130: 87% rage focused_rage(3), precise_strikes, shattered_defenses
2:35.298 single R mortal_strike Fluffy_Pillow 96.6/130: 74% rage focused_rage(3), precise_strikes, shattered_defenses
2:36.584 single P colossus_smash Fluffy_Pillow 98.2/130: 76% rage
2:36.584 single Q focused_rage Fluffy_Pillow 86.2/130: 66% rage focused_rage, precise_strikes, shattered_defenses
2:37.865 single Q focused_rage Fluffy_Pillow 99.4/130: 76% rage focused_rage(2), precise_strikes, shattered_defenses
2:37.870 single S slam Fluffy_Pillow 99.4/130: 76% rage focused_rage(2), precise_strikes, shattered_defenses
2:39.146 single Q focused_rage Fluffy_Pillow 71.4/130: 55% rage focused_rage(3), precise_strikes, shattered_defenses
2:39.155 single S slam Fluffy_Pillow 71.4/130: 55% rage focused_rage(3), precise_strikes, shattered_defenses
2:40.441 single R mortal_strike Fluffy_Pillow 80.6/130: 62% rage focused_rage(3), precise_strikes, shattered_defenses
2:41.725 single P colossus_smash Fluffy_Pillow 82.2/130: 63% rage
2:41.725 single Q focused_rage Fluffy_Pillow 70.2/130: 54% rage focused_rage, precise_strikes, shattered_defenses
2:43.011 single R mortal_strike Fluffy_Pillow 70.2/130: 54% rage focused_rage, precise_strikes, shattered_defenses
2:44.297 single P colossus_smash Fluffy_Pillow 97.0/130: 75% rage
2:44.297 single Q focused_rage Fluffy_Pillow 85.0/130: 65% rage focused_rage, precise_strikes, shattered_defenses
2:45.578 single Q focused_rage Fluffy_Pillow 73.0/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses
2:45.582 single S slam Fluffy_Pillow 73.0/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses
2:46.859 single Q focused_rage Fluffy_Pillow 70.2/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses
2:46.868 single R mortal_strike Fluffy_Pillow 70.2/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses
2:48.154 single P colossus_smash Fluffy_Pillow 71.8/130: 55% rage
2:48.154 single Q focused_rage Fluffy_Pillow 59.8/130: 46% rage focused_rage, precise_strikes, shattered_defenses
2:49.435 single Q focused_rage Fluffy_Pillow 73.0/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses
2:49.439 single S slam Fluffy_Pillow 73.0/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses
2:50.716 single Q focused_rage Fluffy_Pillow 45.0/130: 35% rage focused_rage(3), precise_strikes, shattered_defenses
2:50.724 single S slam Fluffy_Pillow 45.0/130: 35% rage focused_rage(3), precise_strikes, shattered_defenses
2:52.010 single R mortal_strike Fluffy_Pillow 29.0/130: 22% rage focused_rage(3), precise_strikes, shattered_defenses
2:52.510 single Q focused_rage Fluffy_Pillow 43.8/130: 34% rage focused_rage
2:53.296 single S slam Fluffy_Pillow 43.8/130: 34% rage focused_rage
2:53.791 single Q focused_rage Fluffy_Pillow 15.8/130: 12% rage focused_rage(2)
2:54.581 single T bladestorm Fluffy_Pillow 15.8/130: 12% rage focused_rage(2)
2:56.637 default D warbreaker Fluffy_Pillow 41.0/130: 32% rage focused_rage(2)
2:56.637 single Q focused_rage Fluffy_Pillow 29.0/130: 22% rage focused_rage(3), precise_strikes, shattered_defenses
2:57.922 single R mortal_strike Fluffy_Pillow 29.0/130: 22% rage focused_rage(3), precise_strikes, shattered_defenses
2:57.922 single Q focused_rage Fluffy_Pillow 18.6/130: 14% rage focused_rage
2:59.203 single Q focused_rage Fluffy_Pillow 43.6/130: 34% rage focused_rage(2)
2:59.207 single S slam Fluffy_Pillow 43.6/130: 34% rage focused_rage(2)
3:00.484 single Q focused_rage Fluffy_Pillow 15.6/130: 12% rage focused_rage(3)
3:00.493 default 9 avatar Fluffy_Pillow 15.6/130: 12% rage focused_rage(3)
3:00.560 default 8 battle_cry Fluffy_Pillow 15.6/130: 12% rage avatar, focused_rage(3)
3:00.560 single S slam Fluffy_Pillow 15.6/130: 12% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:01.765 default B focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:01.846 default A heroic_leap Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:01.846 single S slam Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:03.046 default B focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:03.132 single R mortal_strike Fluffy_Pillow 52.5/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:04.327 default B focused_rage Fluffy_Pillow 60.5/130: 47% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:04.418 single S slam Fluffy_Pillow 60.5/130: 47% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:05.618 single Q focused_rage Fluffy_Pillow 84.5/130: 65% rage avatar, focused_rage(2)
3:05.704 single R mortal_strike Fluffy_Pillow 84.5/130: 65% rage avatar, focused_rage(2)
3:06.989 default C colossus_smash Fluffy_Pillow 76.5/130: 59% rage avatar
3:06.989 single Q focused_rage Fluffy_Pillow 64.5/130: 50% rage avatar, focused_rage, precise_strikes, shattered_defenses
3:08.270 single Q focused_rage Fluffy_Pillow 77.7/130: 60% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
3:08.276 single S slam Fluffy_Pillow 77.7/130: 60% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
3:09.551 single Q focused_rage Fluffy_Pillow 49.7/130: 38% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:09.562 single R mortal_strike Fluffy_Pillow 49.7/130: 38% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:10.847 single P colossus_smash Fluffy_Pillow 51.3/130: 39% rage avatar
3:10.847 single Q focused_rage Fluffy_Pillow 39.3/130: 30% rage avatar, focused_rage, precise_strikes, shattered_defenses
3:12.128 single Q focused_rage Fluffy_Pillow 52.5/130: 40% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
3:12.132 single S slam Fluffy_Pillow 52.5/130: 40% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
3:13.419 single S slam Fluffy_Pillow 36.5/130: 28% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
3:14.704 single R mortal_strike Fluffy_Pillow 45.7/130: 35% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
3:15.988 single S slam Fluffy_Pillow 47.3/130: 36% rage avatar
3:17.088 single Q focused_rage Fluffy_Pillow 56.1/130: 43% rage avatar, focused_rage
3:17.273 single S slam Fluffy_Pillow 56.1/130: 43% rage avatar, focused_rage
3:18.558 single S slam Fluffy_Pillow 40.1/130: 31% rage avatar, focused_rage
3:18.858 single Q focused_rage Fluffy_Pillow 12.1/130: 9% rage avatar, focused_rage(2)
3:19.843 Waiting     0.100 sec 12.1/130: 9% rage avatar, focused_rage(2)
3:19.943 single Q focused_rage Fluffy_Pillow 12.1/130: 9% rage avatar, focused_rage(2)
3:20.139 single R mortal_strike Fluffy_Pillow 25.3/130: 19% rage avatar, focused_rage(3)
3:21.420 single Q focused_rage Fluffy_Pillow 5.3/130: 4% rage focused_rage
3:21.424 Waiting     0.300 sec 5.3/130: 4% rage focused_rage
3:21.724 default C colossus_smash Fluffy_Pillow 5.3/130: 4% rage focused_rage
3:23.009 Waiting     0.200 sec 5.3/130: 4% rage focused_rage, precise_strikes, shattered_defenses
3:23.209 single R mortal_strike Fluffy_Pillow 30.5/130: 23% rage focused_rage, precise_strikes, shattered_defenses
3:24.494 single S slam Fluffy_Pillow 32.1/130: 25% rage
3:24.494 single Q focused_rage Fluffy_Pillow 4.1/130: 3% rage focused_rage, horrific_appendages
3:25.779 Waiting     0.500 sec 4.1/130: 3% rage focused_rage, horrific_appendages
3:26.279 single Q focused_rage Fluffy_Pillow 41.8/130: 32% rage focused_rage, horrific_appendages
3:26.279 single S slam Fluffy_Pillow 29.8/130: 23% rage focused_rage(2), horrific_appendages
3:27.565 single P colossus_smash Fluffy_Pillow 13.8/130: 11% rage focused_rage(2), horrific_appendages
3:27.565 single Q focused_rage Fluffy_Pillow 1.8/130: 1% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:28.665 default 8 battle_cry Fluffy_Pillow 1.8/130: 1% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:28.850 single R mortal_strike Fluffy_Pillow 1.8/130: 1% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:28.850 default B focused_rage Fluffy_Pillow 9.8/130: 8% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:30.131 default B focused_rage Fluffy_Pillow 47.5/130: 37% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
3:30.137 single S slam Fluffy_Pillow 47.5/130: 37% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
3:31.412 default B focused_rage Fluffy_Pillow 47.5/130: 37% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
3:31.422 single S slam Fluffy_Pillow 47.5/130: 37% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
3:32.693 default B focused_rage Fluffy_Pillow 84.9/130: 65% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
3:32.707 single S slam Fluffy_Pillow 84.9/130: 65% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
3:33.992 single R mortal_strike Fluffy_Pillow 84.9/130: 65% rage focused_rage(3), horrific_appendages
3:33.992 single Q focused_rage Fluffy_Pillow 64.9/130: 50% rage focused_rage, horrific_appendages
3:35.273 single Q focused_rage Fluffy_Pillow 52.9/130: 41% rage focused_rage(2), horrific_appendages
3:35.278 single S slam Fluffy_Pillow 52.9/130: 41% rage focused_rage(2), horrific_appendages
3:36.554 single Q focused_rage Fluffy_Pillow 50.1/130: 39% rage focused_rage(3)
3:36.562 single S slam Fluffy_Pillow 50.1/130: 39% rage focused_rage(3)
3:37.848 single S slam Fluffy_Pillow 34.1/130: 26% rage focused_rage(3)
3:39.133 single R mortal_strike Fluffy_Pillow 43.3/130: 33% rage focused_rage(3)
3:39.133 single Q focused_rage Fluffy_Pillow 23.3/130: 18% rage focused_rage
3:40.418 default C colossus_smash Fluffy_Pillow 23.3/130: 18% rage focused_rage
3:41.702 single R mortal_strike Fluffy_Pillow 48.5/130: 37% rage focused_rage, precise_strikes, shattered_defenses
3:41.702 single Q focused_rage Fluffy_Pillow 38.1/130: 29% rage focused_rage
3:42.986 single S slam Fluffy_Pillow 38.1/130: 29% rage focused_rage
3:44.272 single S slam Fluffy_Pillow 22.1/130: 17% rage focused_rage
3:45.557 single S slam Fluffy_Pillow 31.3/130: 24% rage focused_rage
3:46.843 default A heroic_leap Fluffy_Pillow 15.3/130: 12% rage focused_rage
3:46.846 Waiting     1.000 sec 15.3/130: 12% rage focused_rage
3:47.846 single R mortal_strike Fluffy_Pillow 40.5/130: 31% rage focused_rage
3:48.446 single Q focused_rage Fluffy_Pillow 20.5/130: 16% rage focused_rage
3:49.131 single S slam Fluffy_Pillow 20.5/130: 16% rage focused_rage
3:50.417 Waiting     0.500 sec 4.5/130: 3% rage focused_rage
3:50.917 single Q focused_rage Fluffy_Pillow 29.7/130: 23% rage focused_rage
3:50.917 single R mortal_strike Fluffy_Pillow 17.7/130: 14% rage focused_rage(2)
3:52.204 default C colossus_smash Fluffy_Pillow 9.7/130: 7% rage
3:53.489 single R mortal_strike Fluffy_Pillow 9.7/130: 7% rage precise_strikes, shattered_defenses
3:53.989 single Q focused_rage Fluffy_Pillow 24.5/130: 19% rage focused_rage
3:54.774 single S slam Fluffy_Pillow 24.5/130: 19% rage focused_rage
3:56.060 Waiting     1.000 sec 8.5/130: 7% rage focused_rage
3:57.060 single Q focused_rage Fluffy_Pillow 46.2/130: 36% rage focused_rage
3:57.060 single S slam Fluffy_Pillow 34.2/130: 26% rage focused_rage(2)
3:58.160 default 8 battle_cry Fluffy_Pillow 18.2/130: 14% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:58.341 default B focused_rage Fluffy_Pillow 18.2/130: 14% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:58.346 single S slam Fluffy_Pillow 18.2/130: 14% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:59.632 default D warbreaker Fluffy_Pillow 18.2/130: 14% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:00.918 single R mortal_strike Fluffy_Pillow 55.1/130: 42% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
4:00.918 default B focused_rage Fluffy_Pillow 63.1/130: 49% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
4:02.199 default B focused_rage Fluffy_Pillow 63.1/130: 49% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:02.204 single S slam Fluffy_Pillow 63.1/130: 49% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:03.480 single Q focused_rage Fluffy_Pillow 87.7/130: 67% rage focused_rage(3)
4:03.490 single S slam Fluffy_Pillow 87.7/130: 67% rage focused_rage(3)
4:04.776 execute N execute Fluffy_Pillow 71.7/130: 55% rage focused_rage(3)
4:06.063 execute K colossus_smash Fluffy_Pillow 39.7/130: 31% rage focused_rage(3)
4:07.349 execute L execute Fluffy_Pillow 64.9/130: 50% rage focused_rage(3), precise_strikes, shattered_defenses
4:08.635 execute M mortal_strike Fluffy_Pillow 52.1/130: 40% rage focused_rage(3)
4:09.921 execute N execute Fluffy_Pillow 69.3/130: 53% rage
4:11.206 execute N execute Fluffy_Pillow 37.3/130: 29% rage
4:12.492 execute N execute Fluffy_Pillow 30.5/130: 23% rage
4:13.779 default C colossus_smash Fluffy_Pillow 0.0/130: 0% rage
4:15.064 Waiting     0.400 sec 0.0/130: 0% rage precise_strikes, shattered_defenses
4:15.464 execute L execute Fluffy_Pillow 25.2/130: 19% rage precise_strikes, shattered_defenses
4:16.750 execute N execute Fluffy_Pillow 12.4/130: 10% rage
4:18.035 Waiting     0.500 sec 0.0/130: 0% rage
4:18.535 execute M mortal_strike Fluffy_Pillow 25.2/130: 19% rage
4:19.820 execute K colossus_smash Fluffy_Pillow 17.2/130: 13% rage
4:21.107 execute M mortal_strike Fluffy_Pillow 17.2/130: 13% rage precise_strikes, shattered_defenses
4:22.394 execute N execute Fluffy_Pillow 44.0/130: 34% rage
4:23.680 execute N execute Fluffy_Pillow 12.0/130: 9% rage
4:24.965 execute N execute Fluffy_Pillow 37.8/130: 29% rage
4:26.250 execute K colossus_smash Fluffy_Pillow 5.8/130: 4% rage
4:27.537 execute O bladestorm Fluffy_Pillow 5.8/130: 4% rage precise_strikes, shattered_defenses
4:29.601 execute L execute Fluffy_Pillow 31.0/130: 24% rage precise_strikes, shattered_defenses
4:30.701 default 9 avatar Fluffy_Pillow 18.2/130: 14% rage avatar
4:30.801 default 8 battle_cry Fluffy_Pillow 18.2/130: 14% rage avatar, corrupted_blood_of_zakajz, battle_cry
4:30.801 default B focused_rage Fluffy_Pillow 18.2/130: 14% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:30.887 execute J execute Fluffy_Pillow 54.7/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:32.082 default B focused_rage Fluffy_Pillow 54.7/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:32.174 default A heroic_leap Fluffy_Pillow 54.7/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:32.174 execute J execute Fluffy_Pillow 54.7/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:33.363 default B focused_rage Fluffy_Pillow 54.7/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:33.459 default C colossus_smash Fluffy_Pillow 54.7/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:34.744 execute I mortal_strike Fluffy_Pillow 91.5/130: 70% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
4:34.744 default B focused_rage Fluffy_Pillow 99.5/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:36.028 execute N execute Fluffy_Pillow 99.5/130: 77% rage avatar, focused_rage
4:37.314 execute K colossus_smash Fluffy_Pillow 92.7/130: 71% rage avatar, focused_rage
4:38.598 execute L execute Fluffy_Pillow 92.7/130: 71% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:39.884 execute N execute Fluffy_Pillow 79.9/130: 61% rage avatar, focused_rage
4:41.169 execute K colossus_smash Fluffy_Pillow 73.1/130: 56% rage avatar, focused_rage
4:42.454 execute L execute Fluffy_Pillow 73.1/130: 56% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:43.739 execute N execute Fluffy_Pillow 85.5/130: 66% rage avatar, focused_rage
4:45.025 execute M mortal_strike Fluffy_Pillow 53.5/130: 41% rage avatar, focused_rage
4:46.310 execute N execute Fluffy_Pillow 70.7/130: 54% rage avatar
4:47.597 execute K colossus_smash Fluffy_Pillow 38.7/130: 30% rage avatar
4:48.882 execute L execute Fluffy_Pillow 38.7/130: 30% rage avatar, precise_strikes, shattered_defenses
4:50.169 execute M mortal_strike Fluffy_Pillow 51.1/130: 39% rage avatar
4:51.455 execute N execute Fluffy_Pillow 43.1/130: 33% rage
4:52.741 execute N execute Fluffy_Pillow 36.3/130: 28% rage
4:54.027 Waiting     1.400 sec 4.3/130: 3% rage
4:55.427 execute M mortal_strike Fluffy_Pillow 29.5/130: 23% rage
4:56.712 execute N execute Fluffy_Pillow 21.5/130: 17% rage
4:57.997 Waiting     0.500 sec 0.0/130: 0% rage
4:58.497 execute N execute Fluffy_Pillow 25.2/130: 19% rage
4:58.497 default 8 battle_cry Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, battle_cry
4:58.497 default B focused_rage Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
4:59.778 default B focused_rage Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:59.782 default D warbreaker Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
5:01.059 default B focused_rage Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:01.066 execute I mortal_strike Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:02.340 default B focused_rage Fluffy_Pillow 45.4/130: 35% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
5:02.352 execute J execute Fluffy_Pillow 45.4/130: 35% rage corrupted_blood_of_zakajz, focused_rage, battle_cry

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 28854 27148 15624 (9742)
Agility 6577 6252 0
Stamina 45204 45204 27164
Intellect 5325 5000 0
Spirit 0 0 0
Health 2712240 2712240 0
Rage 130 130 0
Crit 10.53% 10.53% 2210
Haste 17.09% 17.09% 6407
Damage / Heal Versatility 1.07% 1.07% 508
Attack Power 28854 27148 0
Mastery 86.24% 86.24% 14048
Armor 4362 4362 4362
Run Speed 7 0 406

Gear

Source Slot Average Item Level: 877.00
Local Head Venom-Fanged Barbute
ilevel: 870, stats: { 580 Armor, +2461 Sta, +1641 StrInt, +833 Haste, +644 Mastery }, gems: { +150 Mastery }
Local Neck Raging Furystone Gorget of the Feverflare
ilevel: 865, stats: { +1321 Sta, +812 Haste, +1558 Mastery }, gems: { +150 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mortar Guard Shoulderplates
ilevel: 850, stats: { 512 Armor, +1532 Sta, +1021 StrInt, +712 Mastery, +316 Haste }
Local Chest Insect-Etched Chestplate
ilevel: 895, stats: { 754 Armor, +3106 Sta, +2071 StrInt, +1124 Mastery, +498 Vers }
Local Waist Naj'entus's Vertebrae
ilevel: 910, stats: { 438 Armor, +2680 Sta, +1786 Str, +459 Crit, +827 Mastery }
Local Legs Storm-Battered Legplates
ilevel: 865, stats: { 617 Armor, +2348 Sta, +1566 StrInt, +849 Haste, +600 Mastery }
Local Feet Trampling Warboots
ilevel: 895, stats: { 518 Armor, +2329 Sta, +1553 StrInt, +686 Mastery, +530 Haste }
Local Wrists Dragonbone Wristclamps
ilevel: 875, stats: { 316 Armor, +1450 Sta, +967 StrInt, +568 Mastery, +278 Haste, +362 Avoidance }
Local Hands Archavon's Heavy Hand
ilevel: 910, stats: { 487 Armor, +2680 Sta, +1786 Str, +551 Crit, +735 Haste }
Local Finger1 Grasping Tentacle Loop
ilevel: 870, stats: { +1385 Sta, +1397 Mastery, +1048 Haste }, enchant: { +200 Mastery }
Local Finger2 Mindrend Band
ilevel: 865, stats: { +1321 Sta, +1490 Mastery, +880 Haste, +406 RunSpeed }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 865, stats: { +1036 Mastery }
Local Trinket2 Terrorbound Nexus
ilevel: 850, stats: { +979 Mastery }
Local Back Putrid Carapace
ilevel: 870, stats: { 140 Armor, +923 StrAgiInt, +1385 Sta, +504 Mastery, +326 Crit }, gems: { +150 Mastery }, enchant: { +200 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 897, weapon: { 10399 - 15600, 3.6 }, stats: { +2110 Str, +3166 Sta, +831 Crit, +798 Mastery }, relics: { +52 ilevels, +49 ilevels, +46 ilevels }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Zuan"
origin="https://eu.api.battle.net/wow/character/hyjal/Zuan/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/240/115091952-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=528/herbalism=799
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Za!0222200
artifact=36:0:0:0:0:1136:1:1137:1:1138:1:1139:1:1140:1:1141:1:1142:1:1143:3:1144:3:1145:3:1146:3:1147:3:1148:3:1149:3:1150:3:1151:3:1356:1:1393:7
spec=arms

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=buff.avatar.up&buff.battle_cry.up&debuff.colossus_smash.up|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40&cooldown.battle_cry.remains
actions+=/battle_cry,if=gcd.remains<0.25&cooldown.avatar.remains>=10&(buff.shattered_defenses.up|cooldown.warbreaker.remains>7&cooldown.colossus_smash.remains>7|cooldown.colossus_smash.remains&debuff.colossus_smash.remains>gcd)|!cooldown.colossus_smash.remains<gcd|target.time_to_die<=7
actions+=/avatar,if=gcd.remains<0.25&(buff.battle_cry.up|cooldown.battle_cry.remains<15)|target.time_to_die<=20
actions+=/use_item,name=draught_of_souls,if=equipped.draught_of_souls&((prev_gcd.1.mortal_strike|cooldown.mortal_strike.remains>=3)&buff.battle_cry.remains>=3&debuff.colossus_smash.up&buff.avatar.remains>=3)
actions+=/use_item,name=kiljaedens_burning_wish,if=equipped.kiljaedens_burning_wish&debuff.colossus_smash.up
actions+=/heroic_leap,if=(debuff.colossus_smash.down|debuff.colossus_smash.remains<2)&cooldown.colossus_smash.remains&equipped.weight_of_the_earth|!equipped.weight_of_the_earth&debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|cooldown.mortal_strike.remains)
actions+=/colossus_smash,if=cooldown_react&debuff.colossus_smash.remains<gcd
actions+=/warbreaker,if=debuff.colossus_smash.remains<gcd
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=5&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,target_if=target.health.pct<=20&spell_targets.whirlwind<5
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike,if=cooldown_react
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=cooldown_react&buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/execute,if=rage>90
actions.aoe+=/whirlwind,if=rage>=40
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=rage>100|buff.battle_cry_deadly_calm.up
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>40|buff.cleave.up
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=cooldown_react&buff.battle_cry.up&buff.focused_rage.stack=3
# actions.execute+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=cooldown_react&buff.shattered_defenses.down
actions.execute+=/execute,if=buff.shattered_defenses.up&(rage>=17.6|buff.stone_heart.react)
actions.execute+=/mortal_strike,if=cooldown_react&equipped.archavons_heavy_hand&rage<60|talent.in_for_the_kill.enabled&buff.shattered_defenses.down
actions.execute+=/execute,if=buff.shattered_defenses.down
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=colossus_smash,if=cooldown_react&buff.shattered_defenses.down&(buff.battle_cry.down|buff.battle_cry.up&buff.battle_cry.remains>=gcd|buff.corrupted_blood_of_zakajz.remains>=gcd)
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)&buff.battle_cry.down
#Remove the # above to run out of melee and charge back in for rage.
actions.single+=/focused_rage,if=!buff.battle_cry_deadly_calm.up&buff.focused_rage.stack<3&!cooldown.colossus_smash.up&(rage>=50|debuff.colossus_smash.down|cooldown.battle_cry.remains<=8)|cooldown.battle_cry.remains<=8&cooldown.battle_cry.remains>0&rage>100
actions.single+=/mortal_strike,if=cooldown.battle_cry.remains>8|!buff.battle_cry.remains>(gcd.max*2)&buff.focused_rage.stack<3|buff.battle_cry.remains<=gcd
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/whirlwind,if=spell_targets.whirlwind>1|talent.fervor_of_battle.enabled
actions.single+=/slam,if=spell_targets.whirlwind=1&!talent.fervor_of_battle.enabled
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=venomfanged_barbute,id=139229,bonus_id=1805/1808/1492/3336,gems=150mastery
neck=raging_furystone_gorget,id=130243,bonus_id=1768/689/600/672,gems=150mastery,enchant=mark_of_the_hidden_satyr
shoulders=mortar_guard_shoulderplates,id=137524,bonus_id=3411/1502/3336
back=putrid_carapace,id=134408,bonus_id=3415/1808/1522/3337,gems=150mastery,enchant=200str
chest=insectetched_chestplate,id=139224,bonus_id=1806/1517/3337
tabard=renowned_guild_tabard,id=69210
wrists=dragonbone_wristclamps,id=138218,bonus_id=1805/40/1497/3336
hands=archavons_heavy_hand,id=137060,bonus_id=1811/3458
waist=najentuss_vertebrae,id=137087,bonus_id=3459/3458
legs=stormbattered_legplates,id=139230,bonus_id=1805/1487
feet=trampling_warboots,id=139234,bonus_id=1806/1517/3337
finger1=grasping_tentacle_loop,id=133634,bonus_id=3415/1522/3337,enchant=200mastery
finger2=mindrend_band,id=138220,bonus_id=1805/42/1487,enchant=200mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1805/1487
trinket2=terrorbound_nexus,id=137406,bonus_id=3413/1502/1813
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=139255/143809/137377/0,relic_id=1806:1502/3462:1662:3337/3417:1512:1813/0

# Gear Summary
# gear_ilvl=876.80
# gear_strength=15624
# gear_stamina=27164
# gear_crit_rating=2167
# gear_haste_rating=6281
# gear_mastery_rating=13773
# gear_versatility_rating=498
# gear_speed_rating=406
# gear_avoidance_rating=362
# gear_armor=4362

Islandar

Islandar : 521612 dps

  • Race: Human
  • Class: Warrior
  • Spec: Fury
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
521611.6 521611.6 374.4 / 0.072% 75182.9 / 14.4% 51024.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.2 10.2 Rage 0.00% 57.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Islandar/advanced
Talents
  • 15: Endless Rage (Fury Warrior)
  • 30: Shockwave (Fury Warrior)
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Frothing Berserker (Fury Warrior)
  • 90: Inner Rage (Fury Warrior)
  • 100: Reckless Abandon (Fury Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 789
  • blacksmithing: 760

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Islandar 521612
auto_attack_mh 53791 10.3% 195.9 1.54sec 82479 53896 Direct 195.9 56385 128589 82478 39.3% 4.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.95 195.95 0.00 0.00 1.5303 0.0000 16161579.31 23759052.45 31.98 53896.00 53896.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.10 56.70% 56384.67 38369 72260 56393.42 52938 60008 6264271 9209072 31.98
crit 76.97 39.28% 128589.09 76738 166197 128698.11 120536 139335 9897308 14549980 31.98
miss 7.88 4.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 27047 5.2% 195.9 1.54sec 41471 27099 Direct 195.9 28421 64528 41470 39.3% 4.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.95 195.95 0.00 0.00 1.5303 0.0000 8126065.98 11946086.71 31.98 27098.99 27098.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.08 56.69% 28420.98 19185 36130 28424.72 26678 29853 3157018 4641115 31.98
crit 77.01 39.30% 64528.14 38369 83099 64576.28 60314 69513 4969048 7304971 31.98
miss 7.86 4.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bloodthirst 56945 10.9% 76.8 3.91sec 222931 201396 Direct 76.8 141200 308965 222929 48.7% 0.0%  

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.76 76.76 0.00 0.00 1.1069 0.0000 17111647.32 25155742.42 31.98 201396.43 201396.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.36 51.28% 141200.10 103810 195502 141379.71 130779 157192 5558193 8171070 31.98
crit 37.39 48.72% 308964.93 207620 449655 309146.06 275914 344224 11553454 16984672 31.98
 
 

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down|rage<50
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing ${$sw2*$<mult>} Physical damage and restoring {$117313s1=4}% of your health. |cFFFFFFFFGenerates ${$m3/10} Rage.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.16
 
Brutal Haymaker 3163 (10669) 0.6% (2.0%) 4.8 54.16sec 673598 0 Direct 4.8 133942 312715 199632 36.7% 0.0%  

Stats details: brutal_haymaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.77 4.77 0.00 0.00 0.0000 0.0000 952005.93 1399538.90 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.02 63.26% 133942.22 96456 181652 130579.72 0 181652 404072 594025 31.17
crit 1.75 36.74% 312714.65 192912 417800 268614.62 0 417800 547933 805514 27.46
 
 

Action details: brutal_haymaker

Static Values
  • id:214169
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214169
  • name:Brutal Haymaker
  • school:physical
  • tooltip:Damage taken from the caster increased by {$s2=15}%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:128059.96
  • base_dd_max:128059.96
 
    Brutal Haymaker (_vulnerability) 7506 1.4% 38.7 5.59sec 58421 0 Direct 38.6 58541 0 58541 0.0% 0.0%  

Stats details: brutal_haymaker_vulnerability

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.69 38.61 0.00 0.00 0.0000 0.0000 2260433.38 2260433.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.61 100.00% 58541.19 1 480226 60141.86 33644 160075 2260433 2260433 0.00
 
 

Action details: brutal_haymaker_vulnerability

Static Values
  • id:228784
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228784
  • name:Brutal Haymaker
  • school:physical
  • tooltip:
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:37573.04
  • base_dd_max:37573.04
 
Execute 59595 (89407) 11.5% (17.2%) 28.6 2.16sec 944535 821692 Direct 28.6 366505 888428 629609 50.4% 0.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.56 28.56 0.00 0.00 1.1495 0.0000 17982650.19 26436199.15 31.98 821691.86 821691.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.16 49.59% 366505.43 180707 986928 363804.20 243954 505681 5191483 7631971 31.98
crit 14.40 50.41% 888428.12 361414 2309071 884361.58 561798 1288059 12791167 18804228 31.98
 
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.51
 
    Execute Off-Hand 29813 5.7% 0.0 0.00sec 0 0 Direct 28.6 183245 444129 314958 50.5% 0.0%  

Stats details: execute_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.56 0.00 0.00 0.0000 0.0000 8995958.56 13224911.21 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.14 49.51% 183245.13 90356 493475 181934.89 114887 260807 2591374 3809565 31.98
crit 14.42 50.49% 444129.45 180711 1154562 442031.48 279457 651467 6404585 9415346 31.98
 
 

Action details: execute_offhand

Static Values
  • id:163558
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:163558
  • name:Execute Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.51
 
Furious Slash 19139 3.7% 44.7 5.80sec 128554 117501 Direct 44.7 91714 203949 128555 32.8% 0.0%  

Stats details: furious_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.74 44.74 0.00 0.00 1.0941 0.0000 5751560.76 8455339.11 31.98 117501.09 117501.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.05 67.18% 91714.47 63993 120516 91792.53 79607 102757 2756458 4052255 31.98
crit 14.69 32.82% 203948.56 127986 277188 204734.94 175945 246389 2995103 4403084 31.98
 
 

Action details: furious_slash

Static Values
  • id:100130
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100130
  • name:Furious Slash
  • school:physical
  • tooltip:
  • description:Aggressively strike with your off-hand weapon for ${$sw3*$<mult>} Physical damage.$?a231824[ Increases your Bloodthirst critical strike chance by {$206333s1=15}% until it next deals a critical strike, stacking up to {$206333u=6} times.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.90
 
Mark of the Hidden Satyr 12088 2.3% 19.7 15.25sec 184517 0 Direct 19.7 123455 289419 184512 36.8% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.69 19.69 0.00 0.00 0.0000 0.0000 3632265.06 3632265.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.44 63.21% 123455.31 88660 166972 123418.67 93473 153057 1536185 1536185 0.00
crit 7.24 36.79% 289418.69 177321 384035 289182.42 0 384035 2096080 2096080 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Odyn's Fury 0 (26988) 0.0% (5.2%) 5.9 44.19sec 1376853 1256430

Stats details: odyns_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 1.0959 0.0000 0.00 0.00 0.00 1256429.70 1256429.70
 
 

Action details: odyns_fury

Static Values
  • id:205545
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up&buff.enrage.up
Spelldata
  • id:205545
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.
 
    Odyn's Fury (_mh) 21619 4.1% 0.0 0.00sec 0 0 Direct 5.9 0 547852 547852 100.0% 0.0%  
Periodic 23.6 55226 143858 138767 94.3% 0.0% 7.8%

Stats details: odyns_fury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 5.89 23.55 23.55 0.0000 1.0000 6493685.80 6493685.80 0.00 275740.37 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 5.89 100.00% 547851.54 429250 592365 548032.39 530124 552874 3225597 3225597 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.4 5.74% 55226.43 50819 70130 44014.94 0 70130 74709 74709 0.00
crit 22.2 94.26% 143858.45 101638 161299 143917.02 135263 149494 3193380 3193380 0.00
 
 

Action details: odyns_fury_mh

Static Values
  • id:205546
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205546
  • name:Odyn's Fury
  • school:fire
  • tooltip:Suffering $o3 Fire damage over {$d=4 seconds}.
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.050000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.84
 
    Odyn's Fury (_oh) 5369 1.0% 0.0 0.00sec 0 0 Direct 5.9 0 273926 273926 100.0% 0.0%  

Stats details: odyns_fury_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 5.89 0.00 0.00 0.0000 0.0000 1612798.62 1612798.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 5.89 100.00% 273925.77 214625 296183 274016.19 265062 276437 1612799 1612799 0.00
 
 

Action details: odyns_fury_oh

Static Values
  • id:205547
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205547
  • name:Odyn's Fury
  • school:fire
  • tooltip:
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.84
 
Potion of the Old War 27873 5.3% 26.4 11.46sec 312623 0 Direct 26.4 187591 454193 312636 46.9% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.41 26.41 0.00 0.00 0.0000 0.0000 8255097.47 12135775.23 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.02 53.10% 187590.68 127970 241002 187638.91 135748 234308 2630144 3866560 31.98
crit 12.38 46.90% 454192.93 255940 554305 455522.45 350181 554305 5624954 8269215 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raging Blow 0 (140514) 0.0% (26.9%) 78.0 3.83sec 541139 491538

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.01 0.00 0.00 0.00 1.1009 0.0000 0.00 0.00 0.00 491538.01 491538.01
 
 

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.up
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r
 
    Raging Blow (_oh) 46815 9.0% 0.0 0.00sec 0 0 Direct 78.0 120487 283658 180295 36.7% 0.0%  

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 78.01 0.00 0.00 0.0000 0.0000 14065408.06 20677482.17 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.42 63.35% 120486.87 85274 160593 120569.86 109723 132171 5954421 8753563 31.98
crit 28.59 36.65% 283657.97 170548 369365 284484.88 256916 336217 8110987 11923919 31.98
 
 

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.20
 
    Raging Blow (_mh) 93699 18.0% 0.0 0.00sec 0 0 Direct 78.0 240898 567379 360844 36.7% 0.0%  

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 78.01 0.00 0.00 0.0000 0.0000 28150825.62 41384380.18 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.35 63.26% 240897.68 170548 321187 241075.77 220248 265695 11888833 17477710 31.98
crit 28.66 36.74% 567379.07 341095 738730 568959.44 508778 651397 16261993 23906670 31.98
 
 

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.20
 
Rampage 0 (57151) 0.0% (11.0%) 29.0 8.39sec 592854 413256

Stats details: rampage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.97 0.00 0.00 0.00 1.4346 0.0000 0.00 0.00 0.00 413256.14 413256.14
 
 

Action details: rampage

Static Values
  • id:184367
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:2.0000
  • min_gcd:0.7500
  • base_cost:85.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.meat_cleaver.up
Spelldata
  • id:184367
  • name:Rampage
  • school:physical
  • tooltip:
  • description:Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.
 
    Rampage (1) 4632 0.9% 0.0 0.00sec 0 0 Direct 29.0 32343 71546 48053 40.1% 0.0%  

Stats details: rampage1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.97 0.00 0.00 0.0000 0.0000 1392213.97 2046686.41 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.36 59.92% 32342.67 25295 41423 32353.10 27811 36956 561514 825479 31.98
crit 11.61 40.08% 71546.01 50590 95274 71743.17 59696 84831 830700 1221208 31.98
 
 

Action details: rampage1

Static Values
  • id:218617
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218617
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.67
 
    Rampage (2) 7837 1.5% 0.0 0.00sec 0 0 Direct 29.0 54525 121288 81302 40.1% 0.0%  

Stats details: rampage2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.97 0.00 0.00 0.0000 0.0000 2355508.06 3462819.96 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.35 59.89% 54524.53 45289 62498 54538.86 51403 58034 946095 1390849 31.98
crit 11.62 40.11% 121288.47 90577 143746 121752.54 113977 134163 1409413 2071970 31.98
 
 

Action details: rampage2

Static Values
  • id:184707
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184707
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.02
 
    Rampage (3) 10397 2.0% 0.0 0.00sec 0 0 Direct 29.0 72195 160949 107836 40.2% 0.0%  

Stats details: rampage3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.97 0.00 0.00 0.0000 0.0000 3124256.23 4592952.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.34 59.84% 72194.88 60034 82847 72215.17 68220 75943 1251667 1840069 31.98
crit 11.63 40.16% 160948.98 120068 190548 161526.13 149933 179962 1872589 2752884 31.98
 
 

Action details: rampage3

Static Values
  • id:184709
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184709
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.34
 
    Rampage (4) 15831 3.0% 0.0 0.00sec 0 0 Direct 29.0 108914 243750 164230 41.0% 0.0%  

Stats details: rampage4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.97 0.00 0.00 0.0000 0.0000 4757973.50 6994671.73 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.09 58.98% 108913.77 90841 125360 108943.75 102196 114914 1861045 2735912 31.98
crit 11.88 41.02% 243749.61 181682 288329 244586.32 228475 272310 2896929 4258760 31.98
 
 

Action details: rampage4

Static Values
  • id:201364
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201364
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.06
 
    Rampage (5) 18454 3.5% 0.0 0.00sec 0 0 Direct 29.0 126907 284006 191433 41.1% 0.0%  

Stats details: rampage5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 28.97 0.00 0.00 0.0000 0.0000 5546213.08 8153458.58 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.07 58.93% 126906.52 105849 146072 126939.22 120593 133899 2166563 3185053 31.98
crit 11.90 41.07% 284005.63 211698 335965 284964.75 264958 317301 3379650 4968405 31.98
 
 

Action details: rampage5

Static Values
  • id:201363
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201363
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.36
 
Simple Action Stats Execute Interval
Islandar
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Islandar
  • harmful:false
  • if_expr:
 
Avatar 3.9 88.83sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.92 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 7.2 45.03sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.18 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:50.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:gcd.remains=0&(!talent.reckless_abandon.enabled&(cooldown.bloodthirst.remains=0|buff.enrage.remains>cooldown.bloodthirst.remains))|(talent.reckless_abandon.enabled&(talent.dragon_roar.enabled&buff.dragon_roar.up|!talent.dragon_roar.enabled))
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, reducing its movement speed by {$236027s1=50}% for {$236027d=6 seconds}{$?s103828=false}[, and stunning it for {$7922d=0 milliseconds}][]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Islandar
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Islandar
  • harmful:false
  • if_expr:
 
Heroic Leap 11.5 27.35sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 3.9 0.0 88.3sec 88.7sec 25.12% 25.12% 0.0(0.0) 3.6

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:25.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 7.2 0.0 44.7sec 45.0sec 16.54% 16.54% 0.0(0.0) 7.0

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:16.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Berserking (_) 4.3 45.2 61.8sec 4.4sec 19.02% 19.02% 0.0(0.0) 3.9

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_berserking_
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • berserking__1:1.42%
  • berserking__2:1.41%
  • berserking__3:1.40%
  • berserking__4:1.39%
  • berserking__5:1.38%
  • berserking__6:1.37%
  • berserking__7:1.36%
  • berserking__8:1.35%
  • berserking__9:1.35%
  • berserking__10:1.34%
  • berserking__11:1.32%
  • berserking__12:3.92%

Trigger Attempt Success

  • trigger_pct:99.71%

Spelldata details

  • id:200953
  • name:Berserking
  • tooltip:Attack speed and critical strike chance increased by {$s1=3}%.
  • description:{$@spelldesc200845=Rampage and Execute have a chance to activate Berserking, increasing your attack speed and critical strike chance by {$200953s1=3}% every $200951t sec for {$200951d=12 seconds}.}
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 16.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Enrage 25.2 41.2 12.0sec 4.5sec 70.50% 78.69% 41.2(41.2) 24.8

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • enrage_1:70.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184362
  • name:Enrage
  • tooltip:Attack speed increased by {$s1=100}% and damage taken increased by {$s2=20}%.
  • description:{$@spelldesc184361=Bloodthirst critical strikes $?a206320[or activating Berserker Rage ][]will Enrage you, increasing your attack speed by {$184362s1=100}% and damage you take by {$184362s2=20}% for {$184362d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Frothing Berserker 27.4 3.3 10.5sec 9.5sec 58.80% 58.80% 3.3(3.3) 27.2

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_frothing_berserker
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • frothing_berserker_1:58.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215572
  • name:Frothing Berserker
  • tooltip:Damage done increased by {$s1=15}%. Movement speed increased by {$s2=30}%.
  • description:{$@spelldesc215571=When you reach ${{$s1=1000}/10} Rage, your damage is increased by {$215572s1=15}% and your movement speed by {$215572s2=30}% for {$215572d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Juggernaut 1.0 27.6 36.4sec 2.2sec 20.26% 96.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_juggernaut
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • juggernaut_1:0.49%
  • juggernaut_2:0.57%
  • juggernaut_3:0.66%
  • juggernaut_4:0.77%
  • juggernaut_5:0.79%
  • juggernaut_6:0.79%
  • juggernaut_7:0.77%
  • juggernaut_8:0.76%
  • juggernaut_9:0.75%
  • juggernaut_10:0.75%
  • juggernaut_11:0.74%
  • juggernaut_12:0.74%
  • juggernaut_13:0.74%
  • juggernaut_14:0.73%
  • juggernaut_15:0.72%
  • juggernaut_16:0.72%
  • juggernaut_17:0.73%
  • juggernaut_18:0.73%
  • juggernaut_19:0.73%
  • juggernaut_20:0.73%
  • juggernaut_21:0.74%
  • juggernaut_22:0.73%
  • juggernaut_23:0.71%
  • juggernaut_24:0.68%
  • juggernaut_25:0.62%
  • juggernaut_26:0.54%
  • juggernaut_27:0.46%
  • juggernaut_28:0.36%
  • juggernaut_29:0.29%
  • juggernaut_30:0.22%
  • juggernaut_31:0.16%
  • juggernaut_32:0.12%
  • juggernaut_33:0.08%
  • juggernaut_34:0.07%
  • juggernaut_35:0.05%
  • juggernaut_36:0.03%
  • juggernaut_37:0.02%
  • juggernaut_38:0.02%
  • juggernaut_39:0.01%
  • juggernaut_40:0.01%
  • juggernaut_41:0.00%
  • juggernaut_42:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201009
  • name:Juggernaut
  • tooltip:Execute damage increased by {$s1=5}%.
  • description:{$@spelldesc200875=Execute increases damage dealt by Execute by {$201009s1=5}% for {$201009d=6 seconds}, stacking up to {$201009u=99} times.}
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Legion's Gaze 1.0 375.2 294.5sec 0.8sec 99.97% 99.97% 366.2(366.2) 0.0

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_legions_gaze
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:148.15

Stack Uptimes

  • legions_gaze_1:0.22%
  • legions_gaze_2:0.48%
  • legions_gaze_3:0.11%
  • legions_gaze_4:0.24%
  • legions_gaze_5:0.11%
  • legions_gaze_6:0.24%
  • legions_gaze_7:0.11%
  • legions_gaze_8:0.24%
  • legions_gaze_9:0.11%
  • legions_gaze_10:98.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:230152
  • name:Legion's Gaze
  • tooltip:Critical Strike increased by $w1. This effect is reset if you auto attack a different target.
  • description:{$@spelldesc230150=Your melee auto attacks increase your Critical Strike by {$230152s1=124} for {$230152d=10 seconds}, stacking up to {$230152u=10} times. This effect is reset if you auto attack a different target.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Odyn's Champion 5.6 0.2 36.9sec 35.4sec 11.47% 9.86% 0.2(0.2) 5.6

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_odyns_champion
  • max_stacks:1
  • duration:6.00
  • cooldown:0.10
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • odyns_champion_1:11.47%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:200986
  • name:Odyn's Champion
  • tooltip:All special ability uses will reduce the cooldown of all abilities by {$200872s1=1} sec.
  • description:{$@spelldesc200872=When you use Rampage, Odyn has a chance to declare you the Champion of the Valarjar for {$200986d=6 seconds}, causing all your offensive abilities to reduce the cooldown of all your abilities by {$s1=1} sec.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 256.1sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Sense Death 4.3 0.0 10.4sec 10.4sec 1.77% 1.77% 0.0(0.0) 0.0

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_sense_death
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • sense_death_1:1.77%

Trigger Attempt Success

  • trigger_pct:14.71%

Spelldata details

  • id:200979
  • name:Sense Death
  • tooltip:Your next Execute will cost 0 rage.
  • description:{$@spelldesc200863=Execute has a {$h=15}% chance to make your next Execute cost no Rage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Taste for Blood 27.9 16.9 9.4sec 5.8sec 53.49% 53.49% 0.0(0.0) 1.1

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_taste_for_blood
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • taste_for_blood_1:35.27%
  • taste_for_blood_2:13.45%
  • taste_for_blood_3:3.99%
  • taste_for_blood_4:0.70%
  • taste_for_blood_5:0.07%
  • taste_for_blood_6:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206333
  • name:Taste for Blood
  • tooltip:Critical strike chance of Bloodthirst increased by {$s1=15}%.
  • description:Furious Slash increases the critical strike chance of Bloodthirst by {$s1=15}%.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Aggramar's Stride

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_aggramars_stride
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.75

Stack Uptimes

  • aggramars_stride_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207438
  • name:Aggramar's Stride
  • tooltip:
  • description:Increases your movement speed by {$s1=75}% of your Haste or Critical Strike, whichever is higher.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (azshari_salad)

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Heroic Leap0.5570.0011.5071.6150.0007.299
Battle Cry0.1180.0490.1950.0000.0000.195
Avatar5.5870.00110.6026.9520.00030.100
Bloodthirst0.5910.00313.81144.80623.00772.163
Odyn's Fury3.7940.0017.7799.3440.00029.369

Resources

Resource Usage Type Count Total Average RPE APR
Islandar
execute Rage 28.6 609.0 21.3 21.3 44301.2
rampage Rage 29.0 2462.6 85.0 85.0 6974.8
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 34.99 (1.13%) 34.99 0.01 0.04%
battle_cry Rage 7.18 332.84 (10.73%) 46.37 384.88 53.63%
bloodthirst Rage 76.76 715.29 (23.07%) 9.32 52.29 6.81%
raging_blow Rage 78.01 360.86 (11.64%) 4.63 29.21 7.49%
mannoroths_bloodletting_manacles Health 57.53 0.00 (0.00%) 0.00 10695704.49 100.00%
melee_main_hand Rage 188.06 1121.51 (36.17%) 5.96 119.72 9.65%
melee_off_hand Rage 188.08 535.42 (17.27%) 2.85 85.26 13.74%
Resource RPS-Gain RPS-Loss
Health 16370.58 0.00
Rage 10.31 10.21
Combat End Resource Mean Min Max
Rage 27.98 0.10 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 9.3%

Statistics & Data Analysis

Fight Length
Sample Data Islandar Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Islandar Damage Per Second
Count 9999
Mean 521611.56
Minimum 455065.38
Maximum 601404.86
Spread ( max - min ) 146339.48
Range [ ( max - min ) / 2 * 100% ] 14.03%
Standard Deviation 19102.4501
5th Percentile 490843.54
95th Percentile 553692.06
( 95th Percentile - 5th Percentile ) 62848.52
Mean Distribution
Standard Deviation 191.0341
95.00% Confidence Intervall ( 521237.14 - 521985.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5153
0.1 Scale Factor Error with Delta=300 3115027
0.05 Scale Factor Error with Delta=300 12460108
0.01 Scale Factor Error with Delta=300 311502700
Priority Target DPS
Sample Data Islandar Priority Target Damage Per Second
Count 9999
Mean 521611.56
Minimum 455065.38
Maximum 601404.86
Spread ( max - min ) 146339.48
Range [ ( max - min ) / 2 * 100% ] 14.03%
Standard Deviation 19102.4501
5th Percentile 490843.54
95th Percentile 553692.06
( 95th Percentile - 5th Percentile ) 62848.52
Mean Distribution
Standard Deviation 191.0341
95.00% Confidence Intervall ( 521237.14 - 521985.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5153
0.1 Scale Factor Error with Delta=300 3115027
0.05 Scale Factor Error with Delta=300 12460108
0.01 Scale Factor Error with Delta=300 311502700
DPS(e)
Sample Data Islandar Damage Per Second (Effective)
Count 9999
Mean 521611.56
Minimum 455065.38
Maximum 601404.86
Spread ( max - min ) 146339.48
Range [ ( max - min ) / 2 * 100% ] 14.03%
Damage
Sample Data Islandar Damage
Count 9999
Mean 156728146.91
Minimum 112753778.14
Maximum 210391189.66
Spread ( max - min ) 97637411.51
Range [ ( max - min ) / 2 * 100% ] 31.15%
DTPS
Sample Data Islandar Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Islandar Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Islandar Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Islandar Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Islandar Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Islandar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data IslandarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Islandar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 charge
7 0.00 run_action_list,name=movement,if=movement.distance>5
This is mostly to prevent cooldowns from being accidentally used during movement.
8 11.49 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
9 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
A 7.18 battle_cry,if=gcd.remains=0&(!talent.reckless_abandon.enabled&(cooldown.bloodthirst.remains=0|buff.enrage.remains>cooldown.bloodthirst.remains))|(talent.reckless_abandon.enabled&(talent.dragon_roar.enabled&buff.dragon_roar.up|!talent.dragon_roar.enabled))
0.00 battle_cry,if=gcd.remains=0&talent.reckless_abandon.enabled
0.00 battle_cry,if=gcd.remains=0&buff.dragon_roar.up&(cooldown.bloodthirst.remains=0|buff.enrage.remains>cooldown.bloodthirst.remains)
B 3.92 avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
0.00 bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
0.00 blood_fury,if=buff.battle_cry.up
0.00 berserking,if=buff.battle_cry.up
0.00 arcane_torrent,if=rage<rage.max-40
C 0.00 run_action_list,name=cooldowns,if=buff.battle_cry.up
D 0.00 call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
E 0.00 call_action_list,name=aoe,if=spell_targets.whirlwind>3
F 0.00 run_action_list,name=execute,if=target.health.pct<20
G 0.00 run_action_list,name=single_target,if=target.health.pct>20
actions.cooldowns
# count action,conditions
0.00 rampage,if=talent.massacre.enabled&buff.massacre.react&buff.enrage.remains<1
I 2.60 bloodthirst,if=target.health.pct<20&buff.enrage.remains<1
J 5.17 execute
K 12.62 raging_blow,if=buff.enrage.up
L 6.09 rampage,if=talent.reckless_abandon.enabled
0.00 berserker_rage,if=talent.outburst.enabled&buff.enrage.down&buff.battle_cry.up
M 4.82 bloodthirst,if=buff.enrage.remains<1&!talent.outburst.enabled
0.00 use_item,name=draught_of_souls,if=equipped.trinket=draught_of_souls,if=buff.battle_cry.remains>3&((talent.dragon_roar.enabled&buff.dragon_roar.remains>=3)|!talent.dragon_roar.enabled)
0.00 raging_blow
N 5.89 odyns_fury
O 2.10 bloodthirst
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
P 5.23 furious_slash
actions.execute
# count action,conditions
0.00 bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
Q 1.52 execute,if=artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2)|buff.stone_heart.react
0.00 rampage,if=buff.massacre.react&buff.enrage.remains<1
R 21.88 execute
S 12.14 bloodthirst
T 9.41 raging_blow
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
U 0.73 furious_slash
actions.single_target
# count action,conditions
0.00 bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
0.00 execute,if=buff.stone_heart.react
0.00 furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
V 41.03 raging_blow,if=buff.enrage.up
W 22.88 rampage,if=(buff.enrage.down&!talent.frothing_berserker.enabled)|buff.massacre.react&cooldown.raging_blow.remains>1|rage>=100
X 14.95 raging_blow
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
Y 55.10 bloodthirst
Z 38.77 furious_slash
a 0.00 call_action_list,name=bladestorm
0.00 bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

Sample Sequence

0124568ABLKNOKPOKZWVYZVYZXYWVYZVYZX8WYVZYXZYVWYVZYXZYVWYAKLNKM8PVYWVYZXYWVYZXYZVWYV8ZYVWYVABLNKMPKYWVYZVYZV8WYVZYVZYWVYZXYZVWYVZYVZYWA8KLNKMZVYWVYZXYZXYWVY8ZXYZXYWVYZXYABLKNMKPYW8VYZVYZWVYZXYZVWYVZ8YVWYVALNKMPKYWVYZVYWVYZX8YZXYZWVYZXYZVWYVQAB9I8JJIJJRRRSRRSTRSTRSTRSTUQR8STRSTRSTRSRTRRAIJJIJJRRRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Islandar 0.0/100: 0% rage
Pre precombat 1 food Islandar 0.0/100: 0% rage
Pre precombat 2 augmentation Islandar 0.0/100: 0% rage
Pre precombat 4 potion Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 default 6 charge Fluffy_Pillow 9.9/100: 10% rage bloodlust, legions_gaze(2), potion_of_the_old_war
0:00.000 default 8 heroic_leap Fluffy_Pillow 44.9/100: 45% rage bloodlust, legions_gaze(2), potion_of_the_old_war
0:00.000 default A battle_cry Fluffy_Pillow 44.9/100: 45% rage bloodlust, legions_gaze(2), potion_of_the_old_war
0:00.000 default B avatar Fluffy_Pillow 100.0/100: 100% rage bloodlust, frothing_berserker, battle_cry, legions_gaze(2), potion_of_the_old_war
0:00.000 cooldowns L rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, frothing_berserker, battle_cry, legions_gaze(2), potion_of_the_old_war
0:01.179 cooldowns K raging_blow Fluffy_Pillow 15.0/100: 15% rage bloodlust, avatar, frothing_berserker, enrage, battle_cry, legions_gaze(2), potion_of_the_old_war
0:02.063 cooldowns N odyns_fury Fluffy_Pillow 20.0/100: 20% rage bloodlust, avatar, frothing_berserker, enrage, battle_cry, legions_gaze(2), potion_of_the_old_war
0:02.948 cooldowns O bloodthirst Fluffy_Pillow 29.9/100: 30% rage bloodlust, avatar, frothing_berserker, enrage, battle_cry, legions_gaze(4), potion_of_the_old_war
0:03.835 cooldowns K raging_blow Fluffy_Pillow 49.8/100: 50% rage bloodlust, avatar, frothing_berserker, enrage, battle_cry, legions_gaze(6), potion_of_the_old_war
0:04.721 cooldowns P furious_slash Fluffy_Pillow 64.7/100: 65% rage bloodlust, avatar, frothing_berserker, enrage, battle_cry, legions_gaze(8), potion_of_the_old_war
0:05.606 cooldowns O bloodthirst Fluffy_Pillow 74.6/100: 75% rage bloodlust, avatar, frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10), potion_of_the_old_war
0:06.491 cooldowns K raging_blow Fluffy_Pillow 94.5/100: 94% rage bloodlust, avatar, enrage, battle_cry, legions_gaze(10), potion_of_the_old_war
0:07.377 single_target Z furious_slash Fluffy_Pillow 99.5/100: 99% rage bloodlust, avatar, frothing_berserker, enrage, legions_gaze(10), potion_of_the_old_war
0:08.264 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10), potion_of_the_old_war
0:09.444 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10), potion_of_the_old_war
0:10.330 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10), potion_of_the_old_war
0:11.214 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10), potion_of_the_old_war
0:12.101 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage bloodlust, avatar, frothing_berserker, enrage, taste_for_blood(2), legions_gaze(10), potion_of_the_old_war
0:12.987 single_target Y bloodthirst Fluffy_Pillow 74.6/100: 75% rage bloodlust, avatar, taste_for_blood(2), legions_gaze(10), potion_of_the_old_war
0:13.873 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage bloodlust, avatar, taste_for_blood(2), legions_gaze(10), potion_of_the_old_war
0:14.758 single_target X raging_blow Fluffy_Pillow 84.6/100: 85% rage bloodlust, avatar, taste_for_blood(3), legions_gaze(10), potion_of_the_old_war
0:15.644 single_target Y bloodthirst Fluffy_Pillow 96.2/100: 96% rage bloodlust, avatar, taste_for_blood(3), legions_gaze(10), potion_of_the_old_war
0:16.527 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, frothing_berserker, enrage, legions_gaze(10), potion_of_the_old_war
0:17.706 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, avatar, frothing_berserker, enrage, legions_gaze(10), potion_of_the_old_war
0:18.591 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, avatar, frothing_berserker, enrage, odyns_champion, legions_gaze(10), potion_of_the_old_war
0:19.476 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, avatar, frothing_berserker, enrage, odyns_champion, legions_gaze(10), potion_of_the_old_war
0:20.362 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage bloodlust, frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10), potion_of_the_old_war
0:21.246 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage bloodlust, frothing_berserker, taste_for_blood, odyns_champion, legions_gaze(10), potion_of_the_old_war
0:22.131 single_target Z furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, taste_for_blood, odyns_champion, legions_gaze(10), potion_of_the_old_war
0:23.015 single_target X raging_blow Fluffy_Pillow 94.5/100: 94% rage bloodlust, taste_for_blood(2), odyns_champion, legions_gaze(10)
0:23.901 default 8 heroic_leap Fluffy_Pillow 100.0/100: 100% rage bloodlust, frothing_berserker, taste_for_blood(2), legions_gaze(10)
0:24.000 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, frothing_berserker, taste_for_blood(2), legions_gaze(10)
0:25.179 single_target Y bloodthirst Fluffy_Pillow 15.0/100: 15% rage bloodlust, frothing_berserker, enrage, taste_for_blood(2), legions_gaze(10)
0:26.065 single_target V raging_blow Fluffy_Pillow 34.9/100: 35% rage bloodlust, frothing_berserker, enrage, taste_for_blood(2), legions_gaze(10)
0:26.951 single_target Z furious_slash Fluffy_Pillow 49.8/100: 50% rage bloodlust, frothing_berserker, enrage, taste_for_blood(2), legions_gaze(10)
0:27.838 single_target Y bloodthirst Fluffy_Pillow 59.7/100: 60% rage bloodlust, frothing_berserker, enrage, taste_for_blood(3), legions_gaze(10)
0:28.723 single_target X raging_blow Fluffy_Pillow 79.6/100: 80% rage bloodlust, frothing_berserker, taste_for_blood(3), legions_gaze(10)
0:29.609 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage bloodlust, taste_for_blood(3), legions_gaze(10)
0:30.495 single_target Y bloodthirst Fluffy_Pillow 84.6/100: 85% rage bloodlust, taste_for_blood(4), legions_gaze(10)
0:31.381 single_target V raging_blow Fluffy_Pillow 100.0/100: 100% rage bloodlust, frothing_berserker, enrage, legions_gaze(10)
0:32.266 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, frothing_berserker, enrage, legions_gaze(10)
0:33.447 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage bloodlust, frothing_berserker, enrage, legions_gaze(10)
0:34.333 single_target V raging_blow Fluffy_Pillow 44.8/100: 45% rage bloodlust, frothing_berserker, enrage, legions_gaze(10)
0:35.218 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, frothing_berserker, enrage, legions_gaze(10)
0:36.104 single_target Y bloodthirst Fluffy_Pillow 69.6/100: 70% rage bloodlust, frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
0:36.989 single_target X raging_blow Fluffy_Pillow 79.6/100: 80% rage bloodlust, taste_for_blood, legions_gaze(10)
0:37.874 single_target Z furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, taste_for_blood, legions_gaze(10)
0:38.760 single_target Y bloodthirst Fluffy_Pillow 94.5/100: 94% rage bloodlust, taste_for_blood(2), legions_gaze(10)
0:39.645 single_target V raging_blow Fluffy_Pillow 100.0/100: 100% rage bloodlust, frothing_berserker, enrage, legions_gaze(10)
0:40.686 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, legions_gaze(10)
0:42.190 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, odyns_champion, legions_gaze(10)
0:43.000 default A battle_cry Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, odyns_champion, battle_cry, legions_gaze(10)
0:43.340 cooldowns K raging_blow Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, odyns_champion, battle_cry, legions_gaze(10)
0:44.491 cooldowns L rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, odyns_champion, battle_cry, legions_gaze(10)
0:45.996 cooldowns N odyns_fury Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, odyns_champion, battle_cry, berserking_, legions_gaze(10)
0:47.146 cooldowns K raging_blow Fluffy_Pillow 34.8/100: 35% rage frothing_berserker, enrage, odyns_champion, battle_cry, berserking_(2), legions_gaze(10)
0:48.297 cooldowns M bloodthirst Fluffy_Pillow 49.7/100: 50% rage frothing_berserker, enrage, battle_cry, berserking_(3), legions_gaze(10)
0:49.448 default 8 heroic_leap Fluffy_Pillow 59.7/100: 60% rage enrage, battle_cry, berserking_(4), legions_gaze(10)
0:49.448 cooldowns P furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, battle_cry, berserking_(4), legions_gaze(10)
0:50.597 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, berserking_(6), legions_gaze(10)
0:51.746 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, berserking_(7), legions_gaze(10)
0:52.895 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood, berserking_(8), legions_gaze(10)
0:54.398 single_target V raging_blow Fluffy_Pillow 34.8/100: 35% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, berserking_(9), legions_gaze(10)
0:55.547 single_target Y bloodthirst Fluffy_Pillow 49.7/100: 50% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, berserking_(11), legions_gaze(10)
0:56.697 single_target Z furious_slash Fluffy_Pillow 69.6/100: 70% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, berserking_(12), legions_gaze(10)
0:57.846 single_target X raging_blow Fluffy_Pillow 79.5/100: 79% rage frothing_berserker, taste_for_blood(2), odyns_champion, berserking_(12), legions_gaze(10)
0:58.997 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage taste_for_blood(2), odyns_champion, berserking_(12), legions_gaze(10)
1:00.148 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood(2), odyns_champion, legions_gaze(10)
1:01.653 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood(2), berserking_, legions_gaze(10)
1:02.801 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage frothing_berserker, enrage, taste_for_blood(2), berserking_(2), legions_gaze(10)
1:03.950 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, taste_for_blood(2), berserking_(3), legions_gaze(10)
1:05.099 single_target X raging_blow Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, taste_for_blood(3), berserking_(4), legions_gaze(10)
1:06.249 single_target Y bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood(3), berserking_(6), legions_gaze(10)
1:07.399 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage, berserking_(7), legions_gaze(10)
1:08.550 single_target V raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, berserking_(8), legions_gaze(10)
1:09.698 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, berserking_(9), legions_gaze(10)
1:11.202 single_target Y bloodthirst Fluffy_Pillow 34.8/100: 35% rage frothing_berserker, enrage, taste_for_blood, berserking_(11), legions_gaze(10)
1:12.352 single_target V raging_blow Fluffy_Pillow 54.7/100: 55% rage frothing_berserker, enrage, berserking_(12), legions_gaze(10)
1:13.502 default 8 heroic_leap Fluffy_Pillow 69.6/100: 70% rage frothing_berserker, enrage, berserking_(12), legions_gaze(10)
1:13.502 single_target Z furious_slash Fluffy_Pillow 69.6/100: 70% rage frothing_berserker, enrage, berserking_(12), legions_gaze(10)
1:14.653 single_target Y bloodthirst Fluffy_Pillow 79.5/100: 79% rage enrage, taste_for_blood, berserking_(12), legions_gaze(10)
1:15.802 single_target V raging_blow Fluffy_Pillow 99.4/100: 99% rage frothing_berserker, enrage, legions_gaze(10)
1:16.952 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, legions_gaze(10)
1:18.456 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, odyns_champion, legions_gaze(10)
1:19.604 single_target V raging_blow Fluffy_Pillow 44.8/100: 45% rage frothing_berserker, enrage, odyns_champion, legions_gaze(10)
1:20.752 default A battle_cry Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, odyns_champion, legions_gaze(10)
1:21.000 default B avatar Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, odyns_champion, battle_cry, legions_gaze(10)
1:21.000 cooldowns L rampage Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, odyns_champion, battle_cry, legions_gaze(10)
1:22.504 cooldowns N odyns_fury Fluffy_Pillow 24.9/100: 25% rage avatar, frothing_berserker, enrage, odyns_champion, battle_cry, legions_gaze(10)
1:23.652 cooldowns K raging_blow Fluffy_Pillow 34.8/100: 35% rage avatar, frothing_berserker, enrage, odyns_champion, battle_cry, legions_gaze(10)
1:24.804 cooldowns M bloodthirst Fluffy_Pillow 49.7/100: 50% rage avatar, frothing_berserker, enrage, battle_cry, legions_gaze(10)
1:25.953 cooldowns P furious_slash Fluffy_Pillow 69.6/100: 70% rage avatar, frothing_berserker, enrage, battle_cry, legions_gaze(10)
1:27.103 cooldowns K raging_blow Fluffy_Pillow 79.5/100: 79% rage avatar, enrage, taste_for_blood, battle_cry, legions_gaze(10)
1:28.253 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage avatar, enrage, taste_for_blood, legions_gaze(10)
1:29.403 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, legions_gaze(10)
1:30.907 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, frothing_berserker, enrage, legions_gaze(10)
1:32.056 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, frothing_berserker, enrage, legions_gaze(10)
1:33.205 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage avatar, frothing_berserker, enrage, legions_gaze(10)
1:34.357 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:35.506 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage avatar, enrage, taste_for_blood, legions_gaze(10)
1:36.656 single_target Z furious_slash Fluffy_Pillow 94.5/100: 94% rage avatar, enrage, legions_gaze(10)
1:37.805 single_target V raging_blow Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:38.956 default 8 heroic_leap Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:38.956 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:40.460 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage avatar, frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:41.610 single_target V raging_blow Fluffy_Pillow 44.8/100: 45% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:42.760 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood, legions_gaze(10)
1:43.911 single_target Y bloodthirst Fluffy_Pillow 69.6/100: 70% rage taste_for_blood(2), legions_gaze(10)
1:45.060 single_target V raging_blow Fluffy_Pillow 79.6/100: 80% rage enrage, legions_gaze(10)
1:46.211 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage, legions_gaze(10)
1:47.361 single_target Y bloodthirst Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, legions_gaze(10)
1:48.513 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood, legions_gaze(10)
1:50.017 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:51.167 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:52.316 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:53.467 single_target X raging_blow Fluffy_Pillow 69.6/100: 70% rage taste_for_blood(2), legions_gaze(10)
1:54.616 single_target Y bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood(2), legions_gaze(10)
1:55.766 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage, legions_gaze(10)
1:56.916 single_target V raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, legions_gaze(10)
1:58.066 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
1:59.569 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
2:00.717 single_target V raging_blow Fluffy_Pillow 44.8/100: 45% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
2:01.866 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
2:03.016 single_target Y bloodthirst Fluffy_Pillow 69.6/100: 70% rage taste_for_blood(2), legions_gaze(10)
2:04.164 single_target V raging_blow Fluffy_Pillow 79.6/100: 80% rage enrage, legions_gaze(10)
2:05.312 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage, legions_gaze(10)
2:06.463 single_target Y bloodthirst Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, legions_gaze(10)
2:07.611 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood, legions_gaze(10)
2:08.000 default A battle_cry Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10)
2:09.115 default 8 heroic_leap Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10)
2:09.115 cooldowns K raging_blow Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10)
2:10.263 cooldowns L rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10)
2:11.768 cooldowns N odyns_fury Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10)
2:12.917 cooldowns K raging_blow Fluffy_Pillow 34.8/100: 35% rage frothing_berserker, enrage, taste_for_blood, battle_cry, legions_gaze(10)
2:14.064 cooldowns M bloodthirst Fluffy_Pillow 49.7/100: 50% rage enrage, battle_cry, legions_gaze(10)
2:15.213 single_target Z furious_slash Fluffy_Pillow 69.6/100: 70% rage enrage, legions_gaze(10)
2:16.361 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, legions_gaze(10)
2:17.509 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, legions_gaze(10)
2:18.659 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood, legions_gaze(10)
2:20.163 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
2:21.312 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
2:22.461 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
2:23.610 single_target X raging_blow Fluffy_Pillow 69.6/100: 70% rage frothing_berserker, taste_for_blood(2), odyns_champion, legions_gaze(10)
2:24.760 single_target Y bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood(2), odyns_champion, legions_gaze(10)
2:25.911 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage taste_for_blood(2), odyns_champion, legions_gaze(10)
2:27.060 single_target X raging_blow Fluffy_Pillow 94.5/100: 94% rage taste_for_blood(3), legions_gaze(10)
2:28.209 single_target Y bloodthirst Fluffy_Pillow 99.5/100: 99% rage frothing_berserker, taste_for_blood(3), legions_gaze(10)
2:29.357 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, legions_gaze(10)
2:30.861 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, legions_gaze(10)
2:32.011 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage frothing_berserker, enrage, legions_gaze(10)
2:33.161 default 8 heroic_leap Fluffy_Pillow 59.7/100: 60% rage enrage, legions_gaze(10)
2:33.161 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, legions_gaze(10)
2:34.311 single_target X raging_blow Fluffy_Pillow 59.7/100: 60% rage taste_for_blood, legions_gaze(10)
2:35.460 single_target Y bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood, legions_gaze(10)
2:36.609 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage taste_for_blood, legions_gaze(10)
2:37.758 single_target X raging_blow Fluffy_Pillow 94.5/100: 94% rage taste_for_blood(2), legions_gaze(10)
2:38.907 single_target Y bloodthirst Fluffy_Pillow 99.5/100: 99% rage frothing_berserker, taste_for_blood(2), legions_gaze(10)
2:40.058 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood(2), legions_gaze(10)
2:41.562 single_target V raging_blow Fluffy_Pillow 15.0/100: 15% rage frothing_berserker, enrage, taste_for_blood(2), odyns_champion, legions_gaze(10)
2:42.711 single_target Y bloodthirst Fluffy_Pillow 29.9/100: 30% rage frothing_berserker, enrage, taste_for_blood(2), odyns_champion, legions_gaze(10)
2:43.861 single_target Z furious_slash Fluffy_Pillow 39.9/100: 40% rage enrage, taste_for_blood(2), odyns_champion, legions_gaze(10)
2:45.009 single_target X raging_blow Fluffy_Pillow 49.8/100: 50% rage taste_for_blood(3), odyns_champion, legions_gaze(10)
2:46.159 single_target Y bloodthirst Fluffy_Pillow 61.4/100: 61% rage taste_for_blood(3), odyns_champion, legions_gaze(10)
2:47.000 default A battle_cry Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood(3), odyns_champion, battle_cry, legions_gaze(10)
2:47.100 default B avatar Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, taste_for_blood(3), odyns_champion, battle_cry, legions_gaze(10)
2:47.309 cooldowns L rampage Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, taste_for_blood(3), odyns_champion, battle_cry, legions_gaze(10)
2:48.813 cooldowns K raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, frothing_berserker, enrage, taste_for_blood(3), battle_cry, legions_gaze(10)
2:49.963 cooldowns N odyns_fury Fluffy_Pillow 39.8/100: 40% rage avatar, frothing_berserker, enrage, taste_for_blood(3), battle_cry, legions_gaze(10)
2:51.114 cooldowns M bloodthirst Fluffy_Pillow 49.7/100: 50% rage avatar, frothing_berserker, enrage, taste_for_blood(3), battle_cry, legions_gaze(10)
2:52.265 cooldowns K raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, frothing_berserker, enrage, battle_cry, legions_gaze(10)
2:53.415 cooldowns P furious_slash Fluffy_Pillow 74.6/100: 75% rage avatar, enrage, battle_cry, legions_gaze(10)
2:54.564 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage avatar, enrage, taste_for_blood, legions_gaze(10)
2:55.713 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, taste_for_blood, legions_gaze(10)
2:57.219 default 8 heroic_leap Fluffy_Pillow 24.9/100: 25% rage avatar, frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
2:57.219 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
2:58.369 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
2:59.519 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage avatar, frothing_berserker, enrage, odyns_champion, legions_gaze(10)
3:00.668 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, frothing_berserker, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
3:01.815 single_target Y bloodthirst Fluffy_Pillow 74.6/100: 75% rage avatar, enrage, taste_for_blood, odyns_champion, legions_gaze(10)
3:02.964 single_target Z furious_slash Fluffy_Pillow 94.5/100: 94% rage avatar, taste_for_blood, odyns_champion, legions_gaze(10)
3:04.113 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, taste_for_blood(2), legions_gaze(10)
3:05.618 single_target V raging_blow Fluffy_Pillow 15.0/100: 15% rage avatar, frothing_berserker, enrage, taste_for_blood(2), berserking_, legions_gaze(10)
3:06.770 single_target Y bloodthirst Fluffy_Pillow 29.9/100: 30% rage avatar, frothing_berserker, enrage, taste_for_blood(2), berserking_(2), legions_gaze(10)
3:07.919 single_target Z furious_slash Fluffy_Pillow 49.8/100: 50% rage frothing_berserker, enrage, taste_for_blood(2), berserking_(3), legions_gaze(10)
3:09.070 single_target X raging_blow Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, taste_for_blood(3), berserking_(4), legions_gaze(10)
3:10.218 single_target Y bloodthirst Fluffy_Pillow 64.7/100: 65% rage taste_for_blood(3), berserking_(6), legions_gaze(10)
3:11.368 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage, berserking_(7), legions_gaze(10)
3:12.518 single_target V raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, berserking_(8), legions_gaze(10)
3:13.666 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, berserking_(9), legions_gaze(10)
3:15.169 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, berserking_(11), legions_gaze(10)
3:16.319 single_target V raging_blow Fluffy_Pillow 44.8/100: 45% rage frothing_berserker, enrage, odyns_champion, berserking_(12), legions_gaze(10)
3:17.467 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, odyns_champion, berserking_(12), legions_gaze(10)
3:18.617 default 8 heroic_leap Fluffy_Pillow 79.5/100: 79% rage enrage, taste_for_blood, odyns_champion, berserking_(12), legions_gaze(10)
3:18.617 single_target Y bloodthirst Fluffy_Pillow 79.5/100: 79% rage enrage, taste_for_blood, odyns_champion, berserking_(12), legions_gaze(10)
3:19.768 single_target V raging_blow Fluffy_Pillow 99.4/100: 99% rage frothing_berserker, enrage, odyns_champion, legions_gaze(10)
3:20.917 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, odyns_champion, legions_gaze(10)
3:22.422 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, legions_gaze(10)
3:23.573 single_target V raging_blow Fluffy_Pillow 34.9/100: 35% rage frothing_berserker, enrage, legions_gaze(10)
3:24.000 default A battle_cry Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, battle_cry, legions_gaze(10)
3:24.723 cooldowns L rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, battle_cry, legions_gaze(10)
3:26.225 cooldowns N odyns_fury Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, battle_cry, legions_gaze(10)
3:27.374 cooldowns K raging_blow Fluffy_Pillow 34.8/100: 35% rage frothing_berserker, enrage, battle_cry, legions_gaze(10)
3:28.523 cooldowns M bloodthirst Fluffy_Pillow 49.7/100: 50% rage frothing_berserker, enrage, battle_cry, legions_gaze(10)
3:29.675 cooldowns P furious_slash Fluffy_Pillow 69.6/100: 70% rage frothing_berserker, enrage, battle_cry, legions_gaze(10)
3:30.824 cooldowns K raging_blow Fluffy_Pillow 79.5/100: 79% rage enrage, taste_for_blood, battle_cry, legions_gaze(10)
3:31.973 single_target Y bloodthirst Fluffy_Pillow 94.4/100: 94% rage enrage, taste_for_blood, legions_gaze(10)
3:33.122 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood, legions_gaze(10)
3:34.626 single_target V raging_blow Fluffy_Pillow 34.8/100: 35% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
3:35.775 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage frothing_berserker, enrage, taste_for_blood, legions_gaze(10)
3:36.922 single_target Z furious_slash Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, enrage, legions_gaze(10)
3:38.072 single_target V raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, legions_gaze(10)
3:39.222 single_target Y bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, legions_gaze(10)
3:40.370 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, legions_gaze(10)
3:41.876 single_target V raging_blow Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, legions_gaze(10)
3:43.026 single_target Y bloodthirst Fluffy_Pillow 39.8/100: 40% rage frothing_berserker, enrage, legions_gaze(10)
3:44.175 single_target Z furious_slash Fluffy_Pillow 49.8/100: 50% rage frothing_berserker, enrage, legions_gaze(10)
3:45.324 single_target X raging_blow Fluffy_Pillow 59.7/100: 60% rage frothing_berserker, taste_for_blood, legions_gaze(10)
3:46.474 default 8 heroic_leap Fluffy_Pillow 71.3/100: 71% rage taste_for_blood, legions_gaze(10)
3:46.474 single_target Y bloodthirst Fluffy_Pillow 71.3/100: 71% rage taste_for_blood, legions_gaze(10)
3:47.624 single_target Z furious_slash Fluffy_Pillow 81.3/100: 81% rage taste_for_blood, legions_gaze(10)
3:48.772 single_target X raging_blow Fluffy_Pillow 84.6/100: 85% rage taste_for_blood(2), legions_gaze(10)
3:49.923 single_target Y bloodthirst Fluffy_Pillow 89.6/100: 90% rage taste_for_blood(2), legions_gaze(10)
3:51.072 single_target Z furious_slash Fluffy_Pillow 99.6/100: 100% rage frothing_berserker, taste_for_blood(2), legions_gaze(10)
3:52.221 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, taste_for_blood(3), legions_gaze(10)
3:53.723 single_target V raging_blow Fluffy_Pillow 15.0/100: 15% rage frothing_berserker, enrage, taste_for_blood(3), odyns_champion, berserking_, legions_gaze(10)
3:54.873 single_target Y bloodthirst Fluffy_Pillow 29.9/100: 30% rage frothing_berserker, enrage, taste_for_blood(3), odyns_champion, berserking_(2), legions_gaze(10)
3:56.022 single_target Z furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage, taste_for_blood(3), odyns_champion, berserking_(3), legions_gaze(10)
3:57.171 single_target X raging_blow Fluffy_Pillow 59.7/100: 60% rage taste_for_blood(4), odyns_champion, berserking_(4), legions_gaze(10)
3:58.319 single_target Y bloodthirst Fluffy_Pillow 64.7/100: 65% rage taste_for_blood(4), odyns_champion, berserking_(6), legions_gaze(10)
3:59.469 single_target Z furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage, odyns_champion, berserking_(7), legions_gaze(10)
4:00.618 single_target V raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, berserking_(8), legions_gaze(10)
4:01.768 single_target W rampage Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, taste_for_blood, berserking_(9), legions_gaze(10)
4:03.272 single_target Y bloodthirst Fluffy_Pillow 24.9/100: 25% rage frothing_berserker, enrage, taste_for_blood, odyns_champion, berserking_(11), legions_gaze(10)
4:04.419 single_target V raging_blow Fluffy_Pillow 54.7/100: 55% rage frothing_berserker, enrage, odyns_champion, berserking_(12), legions_gaze(10)
4:05.569 execute Q execute Fluffy_Pillow 69.6/100: 70% rage frothing_berserker, enrage, odyns_champion, berserking_(12), legions_gaze(10)
4:05.569 default A battle_cry Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), legions_gaze(10)
4:05.569 default B avatar Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), legions_gaze(10)
4:06.717 default 9 potion Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), legions_gaze(10)
4:06.717 cooldowns I bloodthirst Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), legions_gaze(10), potion_of_the_old_war
4:07.868 default 8 heroic_leap Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, juggernaut, odyns_champion, battle_cry, legions_gaze(10), potion_of_the_old_war
4:07.868 cooldowns J execute Fluffy_Pillow 100.0/100: 100% rage avatar, frothing_berserker, enrage, juggernaut, odyns_champion, battle_cry, legions_gaze(10), potion_of_the_old_war
4:09.016 cooldowns J execute Fluffy_Pillow 84.9/100: 85% rage avatar, frothing_berserker, enrage, juggernaut(2), odyns_champion, battle_cry, legions_gaze(10), potion_of_the_old_war
4:10.164 cooldowns I bloodthirst Fluffy_Pillow 59.9/100: 60% rage avatar, frothing_berserker, enrage, sense_death, juggernaut(3), battle_cry, legions_gaze(10), potion_of_the_old_war
4:11.313 cooldowns J execute Fluffy_Pillow 79.8/100: 80% rage avatar, frothing_berserker, enrage, sense_death, juggernaut(3), battle_cry, legions_gaze(10), potion_of_the_old_war
4:12.462 cooldowns J execute Fluffy_Pillow 89.7/100: 90% rage avatar, enrage, juggernaut(4), battle_cry, legions_gaze(10), potion_of_the_old_war
4:13.611 execute R execute Fluffy_Pillow 74.6/100: 75% rage avatar, enrage, juggernaut(5), legions_gaze(10), potion_of_the_old_war
4:14.761 execute R execute Fluffy_Pillow 59.5/100: 59% rage avatar, juggernaut(6), legions_gaze(10), potion_of_the_old_war
4:15.911 execute R execute Fluffy_Pillow 34.5/100: 34% rage avatar, juggernaut(7), legions_gaze(10), potion_of_the_old_war
4:17.061 execute S bloodthirst Fluffy_Pillow 9.5/100: 9% rage avatar, juggernaut(8), legions_gaze(10), potion_of_the_old_war
4:18.211 execute R execute Fluffy_Pillow 26.1/100: 26% rage avatar, juggernaut(8), legions_gaze(10), potion_of_the_old_war
4:19.363 execute R execute Fluffy_Pillow 1.1/100: 1% rage avatar, sense_death, juggernaut(9), legions_gaze(10), potion_of_the_old_war
4:20.512 execute S bloodthirst Fluffy_Pillow 11.0/100: 11% rage avatar, juggernaut(10), legions_gaze(10), potion_of_the_old_war
4:21.662 execute T raging_blow Fluffy_Pillow 21.0/100: 21% rage avatar, juggernaut(10), legions_gaze(10), potion_of_the_old_war
4:22.811 execute R execute Fluffy_Pillow 29.3/100: 29% rage avatar, juggernaut(10), legions_gaze(10), potion_of_the_old_war
4:23.960 execute S bloodthirst Fluffy_Pillow 4.3/100: 4% rage avatar, juggernaut(11), legions_gaze(10), potion_of_the_old_war
4:25.110 execute T raging_blow Fluffy_Pillow 14.3/100: 14% rage avatar, juggernaut(11), legions_gaze(10), potion_of_the_old_war
4:26.259 execute R execute Fluffy_Pillow 29.2/100: 29% rage juggernaut(11), legions_gaze(10), potion_of_the_old_war
4:27.409 execute S bloodthirst Fluffy_Pillow 4.2/100: 4% rage juggernaut(12), legions_gaze(10), potion_of_the_old_war
4:28.558 execute T raging_blow Fluffy_Pillow 24.1/100: 24% rage juggernaut(12), legions_gaze(10), potion_of_the_old_war
4:29.707 execute R execute Fluffy_Pillow 29.1/100: 29% rage juggernaut(12), legions_gaze(10), potion_of_the_old_war
4:30.856 execute S bloodthirst Fluffy_Pillow 7.4/100: 7% rage juggernaut(13), legions_gaze(10), potion_of_the_old_war
4:32.007 execute T raging_blow Fluffy_Pillow 17.4/100: 17% rage juggernaut(13), legions_gaze(10)
4:33.156 execute U furious_slash Fluffy_Pillow 22.4/100: 22% rage juggernaut(13), legions_gaze(10)
4:34.305 execute Q execute Fluffy_Pillow 32.3/100: 32% rage taste_for_blood, juggernaut(13), legions_gaze(10)
4:35.455 execute R execute Fluffy_Pillow 7.3/100: 7% rage taste_for_blood, sense_death, juggernaut(14), berserking_, legions_gaze(10)
4:36.604 default 8 heroic_leap Fluffy_Pillow 10.6/100: 11% rage taste_for_blood, juggernaut(15), berserking_(2), legions_gaze(10)
4:36.604 execute S bloodthirst Fluffy_Pillow 10.6/100: 11% rage taste_for_blood, juggernaut(15), berserking_(2), legions_gaze(10)
4:37.754 execute T raging_blow Fluffy_Pillow 20.6/100: 21% rage taste_for_blood, juggernaut(15), berserking_(3), legions_gaze(10)
4:38.903 execute R execute Fluffy_Pillow 35.5/100: 35% rage taste_for_blood, juggernaut(15), berserking_(4), legions_gaze(10)
4:40.052 execute S bloodthirst Fluffy_Pillow 10.5/100: 10% rage taste_for_blood, juggernaut(16), berserking_(5), legions_gaze(10)
4:41.200 execute T raging_blow Fluffy_Pillow 20.5/100: 20% rage juggernaut(16), berserking_(6), legions_gaze(10)
4:42.348 execute R execute Fluffy_Pillow 35.4/100: 35% rage juggernaut(16), berserking_(8), legions_gaze(10)
4:43.499 execute S bloodthirst Fluffy_Pillow 10.4/100: 10% rage juggernaut(17), berserking_(9), legions_gaze(10)
4:44.649 execute T raging_blow Fluffy_Pillow 23.7/100: 24% rage juggernaut(17), berserking_(10), legions_gaze(10)
4:45.798 execute R execute Fluffy_Pillow 38.6/100: 39% rage juggernaut(17), berserking_(11), legions_gaze(10)
4:46.946 execute S bloodthirst Fluffy_Pillow 13.6/100: 14% rage juggernaut(18), berserking_(12), legions_gaze(10)
4:48.097 execute R execute Fluffy_Pillow 33.5/100: 33% rage enrage, juggernaut(18), berserking_(12), legions_gaze(10)
4:49.246 execute T raging_blow Fluffy_Pillow 18.4/100: 18% rage enrage, juggernaut(19), berserking_(12), legions_gaze(10)
4:50.397 execute R execute Fluffy_Pillow 33.3/100: 33% rage enrage, juggernaut(19), legions_gaze(10)
4:51.547 execute R execute Fluffy_Pillow 18.2/100: 18% rage sense_death, juggernaut(20), legions_gaze(10)
4:52.569 default A battle_cry Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, juggernaut(21), battle_cry, legions_gaze(10)
4:52.696 cooldowns I bloodthirst Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, juggernaut(21), battle_cry, legions_gaze(10)
4:53.845 cooldowns J execute Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, juggernaut(21), battle_cry, legions_gaze(10)
4:54.996 cooldowns J execute Fluffy_Pillow 84.9/100: 85% rage frothing_berserker, enrage, sense_death, juggernaut(22), battle_cry, legions_gaze(10)
4:56.146 cooldowns I bloodthirst Fluffy_Pillow 94.8/100: 95% rage frothing_berserker, enrage, juggernaut(23), battle_cry, legions_gaze(10)
4:57.294 cooldowns J execute Fluffy_Pillow 100.0/100: 100% rage frothing_berserker, enrage, juggernaut(23), battle_cry, legions_gaze(10)
4:58.445 cooldowns J execute Fluffy_Pillow 84.9/100: 85% rage frothing_berserker, enrage, juggernaut(24), battle_cry, legions_gaze(10)
4:59.593 execute R execute Fluffy_Pillow 69.8/100: 70% rage frothing_berserker, enrage, juggernaut(25), legions_gaze(10)
5:00.744 execute R execute Fluffy_Pillow 44.8/100: 45% rage frothing_berserker, sense_death, juggernaut(26), legions_gaze(10)
5:01.893 execute R execute Fluffy_Pillow 54.7/100: 55% rage frothing_berserker, sense_death, juggernaut(27), legions_gaze(10)
5:03.042 execute R execute Fluffy_Pillow 54.7/100: 55% rage juggernaut(28), legions_gaze(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 32028 30322 18647 (12767)
Agility 6577 6252 0
Stamina 54257 54257 29416
Intellect 5325 5000 0
Spirit 0 0 0
Health 3255420 3255420 0
Rage 100 100 0
Crit 17.05% 17.05% 4822
Haste 30.93% 29.91% 11215
Damage / Heal Versatility 4.46% 4.46% 2119
Attack Power 32028 30322 0
Mastery 31.22% 31.22% 5719
Armor 4312 4312 4312
Run Speed 7 0 0
Leech 2.70% 2.70% 621

Gear

Source Slot Average Item Level: 876.00
Local Head Venom-Fanged Barbute
ilevel: 865, stats: { 573 Armor, +2348 Sta, +1566 StrInt, +818 Haste, +631 Mastery, +621 Leech }
Local Neck Hatecoil Commander's Amulet
ilevel: 880, stats: { +1519 Sta, +1558 Haste, +1039 Mastery }, gems: { +150 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Shifting Runes
ilevel: 865, stats: { 529 Armor, +1761 Sta, +1174 StrInt, +613 Crit, +473 Vers }, gems: { +150 Haste }
Local Shirt Dark Silk Shirt
ilevel: 1
Local Chest Gleaming Val'kyr Cuirass
ilevel: 875, stats: { 721 Armor, +2578 Sta, +1719 StrInt, +881 Vers, +623 Haste }
Local Waist Waistplate of Nameless Horror
ilevel: 865, stats: { 397 Armor, +1761 Sta, +1174 StrInt, +660 Haste, +427 Crit, +466 Avoidance }
Local Legs Storm-Battered Legplates
ilevel: 870, stats: { 624 Armor, +2461 Sta, +1641 StrInt, +865 Haste, +612 Mastery }, gems: { +150 Haste }
Local Feet Aggramar's Stride
ilevel: 910, stats: { 536 Armor, +2680 Sta, +1786 StrInt, +459 Haste, +827 Mastery }
Local Wrists Mannoroth's Bloodletting Manacles
ilevel: 910, stats: { 341 Armor, +2010 Sta, +1340 Str, +551 Mastery, +413 Haste }
Local Hands Ravencrest Bonecrush Gauntlets
ilevel: 865, stats: { 441 Armor, +1174 StrInt, +1762 Sta, +753 Crit, +333 Mastery }, gems: { +150 Haste }
Local Finger1 Ring of Contempt
ilevel: 860, stats: { +1261 Sta, +1578 Haste, +723 Vers }, enchant: { +200 Haste }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 845, stats: { +1097 Sta, +1141 Haste, +960 Crit }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Trinket1 Spiked Counterweight
ilevel: 850, stats: { +979 Haste }, gems: { +150 Haste }
Local Trinket2 Eye of Command
ilevel: 860, stats: { +1421 StrAgi }
Local Back Evergreen Vinewrap Drape
ilevel: 890, stats: { 150 Armor, +1112 StrAgiInt, +1668 Sta, +601 Haste, +294 Crit }, enchant: { +200 Str }
Local Main Hand Warswords of the Valarjar
ilevel: 900, weapon: { 10693 - 16041, 3.6 }, stats: { +2170 Str, +3255 Sta, +840 Crit, +807 Mastery }, relics: { +51 ilevels, +48 ilevels, +51 ilevels }
Local Off Hand Warswords of the Valarjar
ilevel: 900, weapon: { 10693 - 16041, 3.6 }, stats: { +2170 Str, +3255 Sta, +840 Crit, +807 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 War Machine (Fury Warrior) Endless Rage (Fury Warrior) Fresh Meat (Fury Warrior)
30 Shockwave (Fury Warrior) Storm Bolt (Fury Warrior) Double Time
45 Wrecking Ball (Fury Warrior) Outburst Avatar
60 Furious Charge (Fury Warrior) Bounding Stride Warpaint (Fury Warrior)
75 Massacre (Fury Warrior) Frothing Berserker (Fury Warrior) Carnage (Fury Warrior)
90 Bloodbath (Fury Warrior) Frenzy (Fury Warrior) Inner Rage (Fury Warrior)
100 Bladestorm (Fury Warrior) Reckless Abandon (Fury Warrior) Dragon Roar (Fury Warrior)

Profile

warrior="Islandar"
origin="https://eu.api.battle.net/wow/character/hyjal/Islandar/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/171/148011179-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=blacksmithing=760/mining=789
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ZZ!1021121
artifact=35:0:0:0:0:980:1:981:1:982:1:984:1:985:1:986:1:987:1:988:3:989:3:990:3:991:3:992:3:993:3:994:3:995:3:996:3:1357:1:1394:3
spec=fury

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/charge
# This is mostly to prevent cooldowns from being accidentally used during movement.
actions+=/run_action_list,name=movement,if=movement.distance>5
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
actions+=/battle_cry,if=gcd.remains=0&(!talent.reckless_abandon.enabled&(cooldown.bloodthirst.remains=0|buff.enrage.remains>cooldown.bloodthirst.remains))|(talent.reckless_abandon.enabled&(talent.dragon_roar.enabled&buff.dragon_roar.up|!talent.dragon_roar.enabled))
actions+=/battle_cry,if=gcd.remains=0&talent.reckless_abandon.enabled
actions+=/battle_cry,if=gcd.remains=0&buff.dragon_roar.up&(cooldown.bloodthirst.remains=0|buff.enrage.remains>cooldown.bloodthirst.remains)
actions+=/avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
actions+=/bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
actions+=/blood_fury,if=buff.battle_cry.up
actions+=/berserking,if=buff.battle_cry.up
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/run_action_list,name=cooldowns,if=buff.battle_cry.up
actions+=/call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
actions+=/call_action_list,name=aoe,if=spell_targets.whirlwind>3
actions+=/run_action_list,name=execute,if=target.health.pct<20
actions+=/run_action_list,name=single_target,if=target.health.pct>20

actions.aoe=bloodthirst,if=buff.enrage.down|rage<50
actions.aoe+=/call_action_list,name=bladestorm
actions.aoe+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.aoe+=/whirlwind,if=buff.meat_cleaver.down
actions.aoe+=/dragon_roar
actions.aoe+=/rampage,if=buff.meat_cleaver.up
actions.aoe+=/bloodthirst
actions.aoe+=/whirlwind

actions.bladestorm=bladestorm,if=buff.enrage.remains>2&(raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets)

actions.cooldowns=rampage,if=talent.massacre.enabled&buff.massacre.react&buff.enrage.remains<1
actions.cooldowns+=/bloodthirst,if=target.health.pct<20&buff.enrage.remains<1
actions.cooldowns+=/execute
actions.cooldowns+=/raging_blow,if=buff.enrage.up
actions.cooldowns+=/rampage,if=talent.reckless_abandon.enabled
actions.cooldowns+=/berserker_rage,if=talent.outburst.enabled&buff.enrage.down&buff.battle_cry.up
actions.cooldowns+=/bloodthirst,if=buff.enrage.remains<1&!talent.outburst.enabled
actions.cooldowns+=/use_item,name=draught_of_souls,if=equipped.trinket=draught_of_souls,if=buff.battle_cry.remains>3&((talent.dragon_roar.enabled&buff.dragon_roar.remains>=3)|!talent.dragon_roar.enabled)
actions.cooldowns+=/raging_blow
actions.cooldowns+=/odyns_fury
actions.cooldowns+=/bloodthirst
actions.cooldowns+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.cooldowns+=/furious_slash

actions.execute=bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
actions.execute+=/execute,if=artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2)|buff.stone_heart.react
actions.execute+=/rampage,if=buff.massacre.react&buff.enrage.remains<1
actions.execute+=/execute
actions.execute+=/bloodthirst
actions.execute+=/raging_blow
actions.execute+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.execute+=/furious_slash

actions.movement=heroic_leap

actions.single_target=bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
actions.single_target+=/execute,if=buff.stone_heart.react
actions.single_target+=/furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
actions.single_target+=/raging_blow,if=buff.enrage.up
actions.single_target+=/rampage,if=(buff.enrage.down&!talent.frothing_berserker.enabled)|buff.massacre.react&cooldown.raging_blow.remains>1|rage>=100
actions.single_target+=/raging_blow
actions.single_target+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.single_target+=/bloodthirst
actions.single_target+=/furious_slash
actions.single_target+=/call_action_list,name=bladestorm
actions.single_target+=/bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

actions.two_targets=whirlwind,if=buff.meat_cleaver.down
actions.two_targets+=/call_action_list,name=bladestorm
actions.two_targets+=/rampage,if=buff.enrage.down|(rage=100&buff.juggernaut.down)|buff.massacre.up
actions.two_targets+=/bloodthirst,if=buff.enrage.down
actions.two_targets+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.two_targets+=/raging_blow,if=talent.inner_rage.enabled&spell_targets.whirlwind=2
actions.two_targets+=/whirlwind,if=spell_targets.whirlwind>2
actions.two_targets+=/dragon_roar
actions.two_targets+=/bloodthirst
actions.two_targets+=/whirlwind

head=venomfanged_barbute,id=139229,bonus_id=1805/41/1487
neck=hatecoil_commanders_amulet,id=134492,bonus_id=3411/1808/1532/3337,gems=150haste,enchant=mark_of_the_hidden_satyr
shoulders=pauldrons_of_shifting_runes,id=139233,bonus_id=1805/1808/1487,gems=150haste
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1512/3337,enchant=200str
chest=gleaming_valkyr_cuirass,id=142431,bonus_id=3468/1492
shirt=dark_silk_shirt,id=4333
tabard=renowned_guild_tabard,id=69210
wrists=mannoroths_bloodletting_manacles,id=137107,bonus_id=1811/3458
hands=ravencrest_bonecrush_gauntlets,id=134519,bonus_id=3413/1808/1517/3337,gems=150haste
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1805/40/1487
legs=stormbattered_legplates,id=139230,bonus_id=1805/1808/1492/3336,gems=150haste
feet=aggramars_stride,id=132443,bonus_id=1811
finger1=ring_of_contempt,id=134490,bonus_id=3411/1512/3337,enchant=200haste
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727/1808/1497/3336,gems=150haste,enchant=200haste
trinket1=spiked_counterweight,id=136715,bonus_id=3410/1808/1502/3336,gems=150haste
trinket2=eye_of_command,id=142167,bonus_id=3453/1472
main_hand=warswords_of_the_valarjar,id=128908,bonus_id=751,gem_id=141261/139262/142511/0,relic_id=3474:1537:3337/1807:1487:3337/3468:1492/0
off_hand=warswords_of_the_valarjar,id=134553

# Gear Summary
# gear_ilvl=875.63
# gear_strength=18647
# gear_stamina=29416
# gear_crit_rating=4727
# gear_haste_rating=10995
# gear_mastery_rating=5607
# gear_versatility_rating=2077
# gear_leech_rating=621
# gear_avoidance_rating=466
# gear_armor=4312

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length: 229 - 375 ( 300.8 )

Performance:

Total Events Processed: 565757810
Max Event Queue: 474
Sim Seconds: 3010388
CPU Seconds: 1360.5000
Physical Seconds: 291.8304
Speed Up: 2213

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Bonerot Bonerot augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Bonerot Bonerot auto_attack_mh 0 5991001 19915 43.84 26158 52317 219.8 219.8 23.2% 19.0% 0.0% 0.0% 1.37sec 8807338 300.83sec
Bonerot Bonerot auto_attack_oh 1 3000236 9973 43.84 13102 26204 219.8 219.8 23.2% 19.0% 0.0% 0.0% 1.37sec 4410631 300.83sec
Bonerot Bonerot avalanche 207150 3463652 11514 13.29 42157 84307 66.7 66.7 23.3% 0.0% 0.0% 0.0% 4.34sec 3463652 300.83sec
Bonerot Bonerot crystalline_swords 205165 6489069 21571 13.33 78863 157721 70.5 66.8 23.1% 0.0% 0.0% 0.0% 8.46sec 6489069 300.83sec
Bonerot Bonerot empower_rune_weapon 47568 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.29sec 0 300.83sec
Bonerot Bonerot flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Bonerot Bonerot frost_fever ticks -55095 4395561 14652 19.98 35684 71412 35.2 99.9 23.3% 0.0% 0.0% 0.0% 8.70sec 4395561 300.83sec
Bonerot Bonerot hypothermia 228322 2401128 7982 1.99 195286 390554 10.0 10.0 23.2% 0.0% 0.0% 0.0% 27.39sec 2401128 300.83sec
Bonerot Bonerot frost_strike 49143 0 0 0.00 0 0 95.4 0.0 0.0% 0.0% 0.0% 0.0% 3.15sec 0 300.83sec
Bonerot Bonerot frost_strike_mh 222026 19180985 63761 19.02 163197 326781 95.4 95.4 23.2% 0.0% 0.0% 0.0% 3.15sec 19180985 300.83sec
Bonerot Bonerot frost_strike_offhand 66196 12470678 41454 19.02 106165 212185 95.4 95.4 23.2% 0.0% 0.0% 0.0% 3.15sec 12470678 300.83sec
Bonerot Bonerot frozen_pulse 195750 14677149 48789 55.08 43131 86243 276.2 276.2 23.2% 0.0% 0.0% 0.0% 1.80sec 14677149 300.83sec
Bonerot Bonerot howling_blast 49184 11821813 39298 7.02 272606 546122 35.2 35.2 23.2% 0.0% 0.0% 0.0% 8.70sec 11821813 300.83sec
Bonerot Bonerot kiljaedens_burning_wish 235999 2847848 9467 0.90 0 634060 4.5 4.5 100.0% 0.0% 0.0% 0.0% 75.30sec 2847848 300.83sec
Bonerot Bonerot mark_of_the_hidden_satyr 191259 2384211 7925 3.80 101695 203208 19.0 19.0 23.2% 0.0% 0.0% 0.0% 15.92sec 2384211 300.83sec
Bonerot Bonerot obliterate 49020 0 0 0.00 0 0 83.5 0.0 0.0% 0.0% 0.0% 0.0% 3.62sec 0 300.83sec
Bonerot Bonerot obliterate_mh 222024 18056933 60024 16.65 112413 293282 83.5 83.5 57.5% 0.0% 0.0% 0.0% 3.62sec 26545402 300.83sec
Bonerot Bonerot obliterate_offhand 66198 11730271 38993 16.65 73077 190627 83.5 83.5 57.4% 0.0% 0.0% 0.0% 3.62sec 17244610 300.83sec
Bonerot Bonerot obliteration 207256 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 92.94sec 0 300.83sec
Bonerot Bonerot pepper_breath ticks -225622 1284435 4281 15.16 16963 0 15.2 75.8 0.0% 0.0% 0.0% 0.0% 19.67sec 1284435 300.83sec
Bonerot Bonerot pillar_of_frost 51271 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.31sec 0 300.83sec
Bonerot Bonerot potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Bonerot Bonerot potion_of_the_old_war 188028 4060748 13499 5.26 124816 249633 26.4 26.4 23.3% 0.0% 0.0% 0.0% 3.36sec 5969683 300.83sec
Bonerot Bonerot razorice 50401 3440382 11436 71.17 7827 15656 356.8 356.8 23.2% 0.0% 0.0% 0.0% 0.84sec 3440382 300.83sec
Bonerot Bonerot remorseless_winter 196770 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 28.71sec 0 300.83sec
Bonerot Bonerot remorseless_winter_damage 196771 2473627 8223 14.96 26765 53522 75.0 75.0 23.2% 0.0% 0.0% 0.0% 3.38sec 2473627 300.83sec
Bonerot Bonerot frozen_soul 204959 294980 981 1.84 25964 51869 9.2 9.2 23.2% 0.0% 0.0% 0.0% 28.65sec 294980 300.83sec
Bonerot Bonerot rend_flesh ticks -221770 2483544 8278 23.20 17383 34750 37.2 116.0 23.2% 0.0% 0.0% 0.0% 8.11sec 2483544 300.83sec
Bonerot Bonerot rending_flesh_trigger 221770 0 0 0.00 0 0 37.3 0.0 0.0% 0.0% 0.0% 0.0% 8.11sec 0 300.83sec
Bonerot Bonerot sindragosas_fury 190778 3057925 10165 0.28 1742741 3485962 1.4 1.4 22.9% 0.0% 0.0% 0.0% 302.64sec 3057925 300.83sec
Bonerot Bonerot unholy_strength 53365 0 0 0.00 0 0 22.9 0.0 0.0% 0.0% 0.0% 0.0% 13.24sec 0 300.83sec
Decalang Decalang augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Decalang Decalang auto_attack_mh 0 5879994 19546 43.94 25365 50735 220.3 220.3 24.2% 19.0% 0.0% 0.0% 1.37sec 8644148 300.83sec
Decalang Decalang auto_attack_oh 1 2944789 9789 43.94 12703 25409 220.3 220.3 24.2% 19.0% 0.0% 0.0% 1.37sec 4329119 300.83sec
Decalang Decalang crystalline_swords 205165 6246573 20765 13.23 75748 151499 70.0 66.4 24.3% 0.0% 0.0% 0.0% 8.50sec 6246573 300.83sec
Decalang Decalang empower_rune_weapon 47568 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.53sec 0 300.83sec
Decalang Decalang flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Decalang Decalang frost_fever ticks -55095 4284286 14281 19.98 34498 68999 34.4 99.9 24.3% 0.0% 0.0% 0.0% 8.90sec 4284286 300.83sec
Decalang Decalang hypothermia 228322 2333450 7757 1.99 188465 376602 10.0 10.0 24.2% 0.0% 0.0% 0.0% 26.45sec 2333450 300.83sec
Decalang Decalang frost_strike 49143 0 0 0.00 0 0 94.3 0.0 0.0% 0.0% 0.0% 0.0% 3.18sec 0 300.83sec
Decalang Decalang frost_strike_mh 222026 18638146 61956 18.81 159024 318176 94.3 94.3 24.2% 0.0% 0.0% 0.0% 3.18sec 18638146 300.83sec
Decalang Decalang frost_strike_offhand 66196 13053908 43393 18.81 111361 222772 94.3 94.3 24.3% 0.0% 0.0% 0.0% 3.18sec 13053908 300.83sec
Decalang Decalang frozen_pulse 195750 14261779 47408 55.22 41462 82906 276.9 276.9 24.3% 0.0% 0.0% 0.0% 1.80sec 14261779 300.83sec
Decalang Decalang howling_blast 49184 13650452 45376 6.85 319696 638652 34.4 34.4 24.3% 0.0% 0.0% 0.0% 8.90sec 13650452 300.83sec
Decalang Decalang mark_of_the_hidden_satyr 191259 2314641 7694 3.82 97354 194494 19.1 19.1 24.3% 0.0% 0.0% 0.0% 15.76sec 2314641 300.83sec
Decalang Decalang obliterate 49020 0 0 0.00 0 0 81.8 0.0 0.0% 0.0% 0.0% 0.0% 3.68sec 0 300.83sec
Decalang Decalang obliterate_mh 222024 16737432 55638 16.31 109058 271831 81.8 81.8 58.7% 0.0% 0.0% 0.0% 3.68sec 24605610 300.83sec
Decalang Decalang obliterate_offhand 66198 11713732 38938 16.31 76336 190300 81.8 81.8 58.7% 0.0% 0.0% 0.0% 3.68sec 17220295 300.83sec
Decalang Decalang obliteration 207256 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.10sec 0 300.83sec
Decalang Decalang pepper_breath ticks -225622 1281696 4272 15.13 16961 0 15.2 75.6 0.0% 0.0% 0.0% 0.0% 19.57sec 1281696 300.83sec
Decalang Decalang pillar_of_frost 51271 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 46.64sec 0 300.83sec
Decalang Decalang potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Decalang Decalang potion_of_the_old_war 188028 4108290 13657 5.27 125278 250555 26.4 26.4 24.2% 0.0% 0.0% 0.0% 3.33sec 6039575 300.83sec
Decalang Decalang razorice 50401 3354513 11151 70.71 7616 15232 354.5 354.5 24.2% 0.0% 0.0% 0.0% 0.85sec 3354513 300.83sec
Decalang Decalang remorseless_winter 196770 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.01sec 0 300.83sec
Decalang Decalang remorseless_winter_damage 196771 3252215 10811 20.05 26038 52074 100.5 100.5 24.3% 0.0% 0.0% 0.0% 2.88sec 3252215 300.83sec
Decalang Decalang frozen_soul 204959 386785 1286 2.47 25169 50371 12.4 12.4 24.2% 0.0% 0.0% 0.0% 24.01sec 386785 300.83sec
Decalang Decalang rend_flesh ticks -221770 2328695 7762 23.41 16021 31993 37.9 117.1 24.2% 0.0% 0.0% 0.0% 7.95sec 2328695 300.83sec
Decalang Decalang rending_flesh_trigger 221770 0 0 0.00 0 0 37.9 0.0 0.0% 0.0% 0.0% 0.0% 7.95sec 0 300.83sec
Decalang Decalang sindragosas_fury 190778 2473341 8222 0.26 1504407 3008816 1.3 1.3 24.1% 0.0% 0.0% 0.0% 316.96sec 2473341 300.83sec
Decalang Decalang unholy_strength 53365 0 0 0.00 0 0 23.0 0.0 0.0% 0.0% 0.0% 0.0% 13.14sec 0 300.83sec
Ethila Ethila augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ethila Ethila auto_attack_mh 0 5810806 19316 40.02 25566 51136 200.7 200.7 32.2% 19.0% 0.0% 0.0% 1.50sec 8542435 300.83sec
Ethila Ethila auto_attack_oh 1 2911803 9679 40.02 12807 25615 200.7 200.7 32.3% 19.0% 0.0% 0.0% 1.50sec 4280627 300.83sec
Ethila Ethila cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 64.50sec 0 300.83sec
Ethila Ethila crystalline_swords 205165 6167377 20501 11.64 79827 159787 61.5 58.4 32.3% 0.0% 0.0% 0.0% 9.67sec 6167377 300.83sec
Ethila Ethila empower_rune_weapon 47568 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 100.13sec 0 300.83sec
Ethila Ethila flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ethila Ethila frost_fever ticks -55095 4769103 15897 19.98 36084 72154 32.5 99.9 32.3% 0.0% 0.0% 0.0% 9.40sec 4769103 300.83sec
Ethila Ethila hypothermia 228322 2605652 8662 1.98 197643 395280 10.0 10.0 32.5% 0.0% 0.0% 0.0% 27.10sec 2605652 300.83sec
Ethila Ethila frost_strike 49143 0 0 0.00 0 0 72.4 0.0 0.0% 0.0% 0.0% 0.0% 4.15sec 0 300.83sec
Ethila Ethila frost_strike_mh 222026 16204032 53865 14.44 169186 338281 72.4 72.4 32.3% 0.0% 0.0% 0.0% 4.15sec 16204032 300.83sec
Ethila Ethila frost_strike_offhand 66196 11347661 37721 14.44 118461 237022 72.4 72.4 32.3% 0.0% 0.0% 0.0% 4.15sec 11347661 300.83sec
Ethila Ethila frozen_pulse 195750 14484090 48147 50.49 43263 86555 253.1 253.1 32.2% 0.0% 0.0% 0.0% 1.97sec 14484090 300.83sec
Ethila Ethila howling_blast 49184 12614739 41933 6.48 293632 587967 32.5 32.5 32.2% 0.0% 0.0% 0.0% 9.40sec 12614739 300.83sec
Ethila Ethila mark_of_the_hidden_satyr 191259 2321642 7717 3.59 97483 194928 18.0 18.0 32.3% 0.0% 0.0% 0.0% 16.53sec 2321642 300.83sec
Ethila Ethila obliterate 49020 0 0 0.00 0 0 77.1 0.0 0.0% 0.0% 0.0% 0.0% 3.90sec 0 300.83sec
Ethila Ethila obliterate_mh 222024 16540011 54982 15.39 109982 275274 77.1 77.1 63.2% 0.0% 0.0% 0.0% 3.90sec 24315383 300.83sec
Ethila Ethila obliterate_offhand 66198 11579237 38491 15.39 76971 192725 77.1 77.1 63.2% 0.0% 0.0% 0.0% 3.90sec 17022575 300.83sec
Ethila Ethila obliteration 207256 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 91.28sec 0 300.83sec
Ethila Ethila pepper_breath ticks -225622 1218302 4061 14.38 16964 0 14.5 71.9 0.0% 0.0% 0.0% 0.0% 20.71sec 1218302 300.83sec
Ethila Ethila pillar_of_frost 51271 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 46.92sec 0 300.83sec
Ethila Ethila potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ethila Ethila potion_of_the_old_war 188028 4172831 13871 4.92 127706 255411 24.7 24.7 32.4% 0.0% 0.0% 0.0% 3.84sec 6134457 300.83sec
Ethila Ethila razorice 50401 3329201 11067 62.24 8065 16131 312.1 312.1 32.3% 0.0% 0.0% 0.0% 0.97sec 3329201 300.83sec
Ethila Ethila remorseless_winter 196770 0 0 0.00 0 0 10.5 0.0 0.0% 0.0% 0.0% 0.0% 26.86sec 0 300.83sec
Ethila Ethila remorseless_winter_damage 196771 2889310 9605 16.42 26527 53022 82.3 82.3 32.3% 0.0% 0.0% 0.0% 3.19sec 2889310 300.83sec
Ethila Ethila frozen_soul 204959 346378 1151 2.02 25861 51755 10.1 10.1 32.4% 0.0% 0.0% 0.0% 26.89sec 346378 300.83sec
Ethila Ethila rend_flesh ticks -221770 2902268 9674 24.36 18001 36043 41.5 121.8 32.3% 0.0% 0.0% 0.0% 7.24sec 2902268 300.83sec
Ethila Ethila rending_flesh_trigger 221770 0 0 0.00 0 0 41.5 0.0 0.0% 0.0% 0.0% 0.0% 7.25sec 0 300.83sec
Ethila Ethila sindragosas_fury 190778 2950728 9809 0.26 1686739 3373090 1.3 1.3 32.1% 0.0% 0.0% 0.0% 315.81sec 2950728 300.83sec
Ethila Ethila unholy_strength 53365 0 0 0.00 0 0 21.7 0.0 0.0% 0.0% 0.0% 0.0% 13.90sec 0 300.83sec
Nebriniel Nebriniel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Nebriniel Nebriniel deadly_grace 188091 4516212 15013 5.77 126674 253378 28.9 28.9 23.2% 0.0% 0.0% 0.0% 7.77sec 4516212 300.83sec
Nebriniel Nebriniel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Nebriniel Nebriniel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Nebriniel Nebriniel full_moon 202771 6689161 22236 1.27 852741 1706261 7.1 6.4 23.0% 0.0% 0.0% 0.0% 43.66sec 6689161 300.83sec
Nebriniel Nebriniel half_moon 202768 3846459 12786 1.48 420235 840470 7.5 7.4 23.1% 0.0% 0.0% 0.0% 42.77sec 3846459 300.83sec
Nebriniel Nebriniel incarnation 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.34sec 0 300.83sec
Nebriniel Nebriniel lunar_strike 194153 22598327 75120 12.05 270549 541083 60.4 60.4 38.3% 0.0% 0.0% 0.0% 4.87sec 22598327 300.83sec
Nebriniel Nebriniel mark_of_the_hidden_satyr 191259 2111268 7018 3.86 88511 176829 19.4 19.4 23.3% 0.0% 0.0% 0.0% 15.50sec 2111268 300.83sec
Nebriniel Nebriniel moonfire 8921 84322 280 0.20 68364 136729 1.0 1.0 23.3% 0.0% 0.0% 0.0% 0.00sec 9358577 300.83sec
Nebriniel Nebriniel moonfire ticks -8921 9274255 30914 40.56 37095 74164 1.0 202.8 23.3% 0.0% 0.0% 0.0% 0.00sec 9358577 300.83sec
Nebriniel Nebriniel moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Nebriniel Nebriniel new_moon 202767 2014547 6697 1.55 210368 420705 6.8 7.8 23.0% 0.0% 0.0% 0.0% 41.95sec 2014547 300.83sec
Nebriniel Nebriniel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Nebriniel Nebriniel shooting_stars 202497 1190308 3957 7.12 27029 54108 40.5 35.7 23.2% 0.0% 0.0% 0.0% 7.25sec 1190308 300.83sec
Nebriniel Nebriniel solar_wrath 190984 24196439 80433 21.18 184927 369841 106.7 106.2 23.2% 0.0% 0.0% 0.0% 2.77sec 24196439 300.83sec
Nebriniel Nebriniel starsurge 78674 29087369 96691 12.17 337535 675408 61.2 61.0 41.2% 0.0% 0.0% 0.0% 4.87sec 29087369 300.83sec
Nebriniel Nebriniel goldrinns_fang 203001 4935947 16408 4.01 199036 398695 20.2 20.1 23.2% 0.0% 0.0% 0.0% 14.53sec 4935947 300.83sec
Nebriniel Nebriniel sunfire 93402 76656 255 0.20 62149 124299 1.0 1.0 23.3% 0.0% 0.0% 0.0% 0.00sec 8479486 300.83sec
Nebriniel Nebriniel sunfire ticks -93402 8402829 28009 40.41 33750 67509 1.0 202.0 23.2% 0.0% 0.0% 0.0% 0.00sec 8479486 300.83sec
Rinotor Rinotor a_murder_of_crows 131894 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.41sec 0 300.83sec
Rinotor Rinotor crow_peck 131900 8845195 29403 17.04 81445 165158 0.0 85.4 26.4% 0.0% 0.0% 0.0% 0.00sec 13003275 300.83sec
Rinotor Rinotor aspect_of_the_wild 193530 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.78sec 0 300.83sec
Rinotor Rinotor augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Rinotor Rinotor auto_shot 0 5075499 16872 24.50 32791 66155 122.8 122.8 25.6% 0.0% 0.0% 0.0% 2.46sec 7461464 300.83sec
Rinotor Rinotor bestial_wrath 19574 0 0 0.00 0 0 8.8 0.0 0.0% 0.0% 0.0% 0.0% 36.17sec 0 300.83sec
Rinotor Rinotor chimaera_shot 53209 0 0 0.00 0 0 35.6 0.0 0.0% 0.0% 0.0% 0.0% 8.42sec 0 300.83sec
Rinotor Rinotor chimaera_shot_frost 171454 3569006 11864 3.56 159193 320032 0.0 17.8 25.5% 0.0% 0.0% 0.0% 0.00sec 3569006 300.83sec
Rinotor Rinotor chimaera_shot_nature 171457 3562323 11842 3.55 159169 320718 0.0 17.8 25.3% 0.0% 0.0% 0.0% 0.00sec 3562323 300.83sec
Rinotor Rinotor cobra_shot 193455 16948832 56341 13.69 194954 393537 68.7 68.6 26.2% 0.0% 0.0% 0.0% 4.38sec 24916389 300.83sec
Rinotor Rinotor dire_beast 120679 0 0 0.00 0 0 32.5 0.0 0.0% 0.0% 0.0% 0.0% 9.39sec 0 300.83sec
Rinotor Rinotor_dire_beast dire_beast_melee 0 7766624 35790 45.50 37556 75120 164.6 164.6 25.7% 0.0% 0.0% 0.0% 1.83sec 11417673 217.01sec
Rinotor Rinotor flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Rinotor Rinotor food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Rinotor Rinotor kill_command 34026 0 0 0.00 0 0 75.1 0.0 0.0% 0.0% 0.0% 0.0% 4.01sec 0 300.83sec
Rinotor Rinotor_cat kill_command 83381 33345579 110846 14.98 319041 647506 75.1 75.1 38.1% 0.0% 0.0% 0.0% 4.01sec 49021159 300.83sec
Rinotor Rinotor_cat jaws_of_thunder 197162 6662756 22148 5.99 221968 0 30.0 30.0 0.0% 0.0% 0.0% 0.0% 9.90sec 6662756 300.83sec
Rinotor Rinotor_hati kill_command 83381 10145466 33725 14.98 106689 215333 75.1 75.1 26.2% 0.0% 0.0% 0.0% 4.01sec 14914796 300.83sec
Rinotor Rinotor_hati jaws_of_thunder 197162 2027026 6738 5.98 67565 0 30.0 30.0 0.0% 0.0% 0.0% 0.0% 9.91sec 2027026 300.83sec
Rinotor Rinotor potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Rinotor Rinotor summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Rinotor Rinotor titans_thunder 207068 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.30sec 0 300.83sec
Rinotor Rinotor_cat titans_thunder ticks -207068 1815614 6052 8.46 33719 68282 5.4 42.3 26.6% 0.0% 0.0% 0.0% 61.30sec 1815614 300.83sec
Rinotor Rinotor_dire_beast titans_thunder ticks -207068 2441295 8138 8.01 48019 96449 5.1 40.0 26.8% 0.0% 0.0% 0.0% 64.31sec 2441295 217.01sec
Rinotor Rinotor_dire_beast titans_thunder ticks -207068 211289 704 0.71 47468 94895 0.5 3.6 25.2% 0.0% 0.0% 0.0% 114.65sec 211289 37.60sec
Rinotor Rinotor_dire_beast titans_thunder ticks -207068 43400 145 0.15 47354 94844 0.1 0.7 25.3% 0.0% 0.0% 0.0% 0.00sec 43400 8.82sec
Rinotor Rinotor_dire_beast titans_thunder ticks -207068 35430 118 0.12 46545 93091 0.1 0.6 27.5% 0.0% 0.0% 0.0% 0.00sec 35430 8.03sec
Rinotor Rinotor_hati titans_thunder ticks -207068 2318445 7728 8.46 43082 87258 5.4 42.3 26.5% 0.0% 0.0% 0.0% 61.30sec 2318445 300.83sec
Rinotor Rinotor tormenting_cyclone 221857 1600983 5322 14.35 17655 35604 10.5 72.0 25.6% 0.0% 0.0% 0.0% 28.02sec 1600983 300.83sec
Rinotor Rinotor_cat claw 16827 13980474 46473 20.10 100547 204825 100.8 100.8 36.6% 0.0% 0.0% 0.0% 3.00sec 20552621 300.83sec
Rinotor Rinotor_cat melee 0 6994577 23251 40.12 25208 51135 201.2 201.2 36.9% 0.0% 0.0% 0.0% 1.49sec 10282691 300.83sec
Rinotor Rinotor_hati hati_melee 0 7468213 24826 36.66 32261 65072 182.8 183.8 25.5% 0.0% 0.0% 0.0% 1.64sec 10978980 300.83sec
Eldiablø Eldiablø aegwynns_ascendance 187677 1069148 3554 0.68 315526 0 3.4 3.4 0.0% 0.0% 0.0% 0.0% 93.84sec 1069148 300.83sec
Eldiablø Eldiablø apply_taint_of_the_sea 0 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 143.52sec 0 300.83sec
Eldiablø Eldiablø apply_temptation 0 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 33.75sec 0 300.83sec
Eldiablø Eldiablø arcane_barrage 44425 4819717 16021 2.77 267730 535477 14.0 13.9 29.5% 0.0% 0.0% 0.0% 18.62sec 4819717 300.83sec
Eldiablø Eldiablø arcane_blast 30451 43291092 143906 20.10 332353 663422 99.8 100.8 29.4% 0.0% 0.0% 0.0% 3.01sec 43291092 300.83sec
Eldiablø Eldiablø arcane_missiles ticks -5143 32862132 109540 47.55 107229 214441 39.7 237.7 29.5% 0.0% 0.0% 0.0% 7.29sec 32862132 300.83sec
Eldiablø Eldiablø arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.31sec 0 300.83sec
Eldiablø Eldiablø augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Eldiablø Eldiablø collapse 234142 642807 2137 1.50 65920 131459 7.5 7.5 29.7% 0.0% 0.0% 0.0% 33.75sec 642807 300.83sec
Eldiablø Eldiablø deadly_grace 188091 4293131 14271 4.60 143780 287673 23.1 23.1 29.4% 0.0% 0.0% 0.0% 5.67sec 4293131 300.83sec
Eldiablø Eldiablø evocation 12051 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 93.43sec 0 300.83sec
Eldiablø Eldiablø flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Eldiablø Eldiablø food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Eldiablø Eldiablø mark_of_aluneth ticks -224968 2636169 8787 6.17 65992 131803 5.2 30.8 29.6% 0.0% 0.0% 0.0% 62.55sec 2636169 300.83sec
Eldiablø Eldiablø mark_of_aluneth_explosion 210726 2399744 7977 1.04 357528 714270 5.2 5.2 29.2% 0.0% 0.0% 0.0% 62.48sec 2399744 300.83sec
Eldiablø Eldiablø potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Eldiablø Eldiablø presence_of_mind 205025 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 89.36sec 0 300.83sec
Eldiablø Eldiablø rune_of_power 116011 0 0 0.00 0 0 8.8 0.0 0.0% 0.0% 0.0% 0.0% 35.25sec 0 300.83sec
Eldiablø Eldiablø touch_of_the_magi 210833 3031803 10078 1.71 353907 0 8.6 8.6 0.0% 0.0% 0.0% 0.0% 32.82sec 3031803 300.83sec
Eldiablø Eldiablø unstable_magic_explosion 157976 4324808 14376 4.02 214514 0 20.0 20.2 0.0% 0.0% 0.0% 0.0% 14.56sec 4324808 300.83sec
Lâstykökö Lâstykökö augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Lâstykökö Lâstykökö blast_furance ticks -194522 1439250 4798 52.19 3277 7076 38.7 260.9 58.9% 0.0% 0.0% 0.0% 7.84sec 1439250 300.83sec
Lâstykökö Lâstykökö combustion 190319 0 0 0.00 0 0 4.2 0.0 0.0% 0.0% 0.0% 0.0% 82.19sec 0 300.83sec
Lâstykökö Lâstykökö conflagration_dot ticks -226757 321335 1071 27.46 2340 0 88.9 137.3 0.0% 0.0% 0.0% 0.0% 3.21sec 321335 300.83sec
Lâstykökö Lâstykökö conflagration_explosion 205023 1076813 3579 5.99 21308 45814 30.0 30.0 59.4% 0.0% 0.0% 0.0% 9.67sec 1076813 300.83sec
Lâstykökö Lâstykökö deadly_grace 188091 4498237 14953 5.41 91067 194524 27.1 27.1 72.2% 0.0% 0.0% 0.0% 4.05sec 4498237 300.83sec
Lâstykökö Lâstykökö dragons_breath 31661 284874 947 0.18 0 308568 0.9 0.9 100.0% 0.0% 0.0% 0.0% 129.34sec 284874 300.83sec
Lâstykökö Lâstykökö fire_blast 108853 8970878 29821 7.71 0 232018 38.7 38.7 100.0% 0.0% 0.0% 0.0% 7.84sec 8970878 300.83sec
Lâstykökö Lâstykökö fireball 133 17424050 57920 17.74 118317 250707 89.1 88.9 58.6% 0.0% 0.0% 0.0% 3.21sec 17424050 300.83sec
Lâstykökö Lâstykökö flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Lâstykökö Lâstykökö food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Lâstykökö Lâstykökö ignite ticks -12846 28309908 94366 59.94 94457 0 229.8 299.7 0.0% 0.0% 0.0% 0.0% 1.32sec 28309908 300.83sec
Lâstykökö Lâstykökö maddening_whispers 222050 3809605 12664 0.45 811618 1783497 2.2 2.2 91.1% 0.0% 0.0% 0.0% 163.17sec 3809605 300.83sec
Lâstykökö Lâstykökö mark_of_the_hidden_satyr 191259 2805166 9325 3.51 94697 203570 17.6 17.6 59.6% 0.0% 0.0% 0.0% 16.86sec 2805166 300.83sec
Lâstykökö Lâstykökö phoenix_reborn 215773 994436 3306 4.98 23676 50894 25.0 25.0 59.4% 0.0% 0.0% 0.0% 11.68sec 994436 300.83sec
Lâstykökö Lâstykökö phoenixs_flames 194466 5809956 19313 2.91 0 398734 14.6 14.6 100.0% 0.0% 0.0% 0.0% 22.49sec 5809956 300.83sec
Lâstykökö Lâstykökö phoenixs_flames_splash 224637 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.37sec 0 300.83sec
Lâstykökö Lâstykökö poisoned_dreams_damage 222705 6159727 20476 18.32 41528 84772 91.8 91.8 59.1% 0.0% 0.0% 0.0% 2.55sec 6159727 300.83sec
Lâstykökö Lâstykökö potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Lâstykökö Lâstykökö pyroblast 11366 51364456 170743 17.17 349814 720746 85.3 86.1 66.6% 0.0% 0.0% 0.0% 3.53sec 51364456 300.83sec
Lâstykökö Lâstykökö scorch 2948 122645 408 0.33 0 73746 1.7 1.7 100.0% 0.0% 0.0% 0.0% 59.31sec 122645 300.83sec
Lâstykökö Lâstykökö time_warp 80353 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 223.73sec 0 300.83sec
Lâstykökö Lâstykökö unstable_magic_explosion 157976 2176286 7234 4.43 97995 0 22.2 22.2 0.0% 0.0% 0.0% 0.0% 12.40sec 2176286 300.83sec
Illaz Illaz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Illaz Illaz blade_of_justice 184575 14187824 47163 9.96 235053 469924 49.9 49.9 20.9% 0.0% 0.0% 0.0% 6.01sec 20857445 300.83sec
Illaz Illaz crusade 231895 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.31sec 0 300.83sec
Illaz Illaz echoed_verdict 224266 4667811 15517 15.20 50730 101378 76.2 76.2 20.8% 0.0% 0.0% 0.0% 3.93sec 4667811 300.83sec
Illaz Illaz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Illaz Illaz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Illaz Illaz horrific_slam 222168 2433117 8088 16.41 24462 48911 82.3 82.3 20.9% 0.0% 0.0% 0.0% 2.80sec 2433117 300.83sec
Illaz Illaz judgment 20271 10904861 36249 6.52 275877 551754 32.7 32.7 20.9% 0.0% 0.0% 0.0% 9.39sec 10904861 300.83sec
Illaz Illaz judgment_aoe 228288 0 0 0.00 0 0 32.7 0.0 0.0% 0.0% 0.0% 0.0% 9.34sec 0 300.83sec
Illaz Illaz melee 0 5626455 18703 23.25 39960 79954 116.6 116.6 20.8% 0.0% 0.0% 0.0% 2.57sec 8271422 300.83sec
Illaz Illaz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Illaz Illaz potion_of_the_old_war 188028 7650411 25431 6.57 192241 384556 32.9 32.9 20.8% 0.0% 0.0% 0.0% 4.77sec 11246829 300.83sec
Illaz Illaz rend_flesh ticks -221770 1322511 4408 13.70 15986 31910 18.9 68.5 20.8% 0.0% 0.0% 0.0% 15.39sec 1322511 300.83sec
Illaz Illaz rending_flesh_trigger 221770 0 0 0.00 0 0 18.9 0.0 0.0% 0.0% 0.0% 0.0% 15.39sec 0 300.83sec
Illaz Illaz shield_of_vengeance 184662 0 0 0.76 0 0 3.8 3.8 20.9% 0.0% 0.0% 0.0% 90.00sec 2328998 300.83sec
Illaz Illaz shield_of_vengeance_proc 184689 3576959 11890 0.72 817332 1634762 3.8 3.6 21.0% 0.0% 0.0% 0.0% 89.42sec 3576959 300.83sec
Illaz Illaz templars_verdict 85256 48052395 159734 15.24 520159 1040577 76.4 76.4 20.9% 0.0% 0.0% 0.0% 3.93sec 48052395 300.83sec
Illaz Illaz wake_of_ashes 205273 3162023 10511 1.98 263536 526975 10.0 10.0 20.6% 0.0% 0.0% 0.0% 31.71sec 6965784 300.83sec
Illaz Illaz wake_of_ashes ticks -205273 3803761 12679 11.81 53284 106543 10.0 59.1 20.9% 0.0% 0.0% 0.0% 31.71sec 6965784 300.83sec
Illaz Illaz zeal 217020 18332479 60940 17.04 154525 309063 85.4 85.4 38.9% 0.0% 0.0% 0.0% 3.48sec 26950481 300.83sec
Jukkayoto Jukkayoto augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Jukkayoto Jukkayoto blade_of_justice 184575 18368513 61060 11.30 272014 543236 56.6 56.6 19.3% 0.0% 0.0% 0.0% 5.32sec 27003453 300.83sec
Jukkayoto Jukkayoto crusade 231895 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.28sec 0 300.83sec
Jukkayoto Jukkayoto crusader_strike 35395 19135303 63609 21.17 131546 262944 106.1 106.1 37.1% 0.0% 0.0% 0.0% 2.79sec 28130708 300.83sec
Jukkayoto Jukkayoto echoed_verdict 224266 6914221 22984 18.49 62511 125138 92.7 92.7 19.3% 0.0% 0.0% 0.0% 3.23sec 6914221 300.83sec
Jukkayoto Jukkayoto flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Jukkayoto Jukkayoto food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Jukkayoto Jukkayoto judgment 20271 11550033 38394 6.93 278833 557949 34.8 34.7 19.2% 0.0% 0.0% 0.0% 8.81sec 11550033 300.83sec
Jukkayoto Jukkayoto judgment_aoe 228288 0 0 0.00 0 0 34.7 0.0 0.0% 0.0% 0.0% 0.0% 8.77sec 0 300.83sec
Jukkayoto Jukkayoto melee 0 7292090 24240 26.35 46290 92548 132.1 132.1 19.3% 0.0% 0.0% 0.0% 2.27sec 10720062 300.83sec
Jukkayoto Jukkayoto potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Jukkayoto Jukkayoto potion_of_the_old_war 188028 10216806 33962 7.87 217133 433844 39.5 39.5 19.3% 0.0% 0.0% 0.0% 3.99sec 15019672 300.83sec
Jukkayoto Jukkayoto rend_flesh ticks -221770 1651879 5506 14.11 19622 39180 19.3 70.5 19.4% 0.0% 0.0% 0.0% 15.33sec 1651879 300.83sec
Jukkayoto Jukkayoto rending_flesh_trigger 221770 0 0 0.00 0 0 19.3 0.0 0.0% 0.0% 0.0% 0.0% 15.33sec 0 300.83sec
Jukkayoto Jukkayoto shield_of_vengeance 184662 0 0 0.76 0 0 3.8 3.8 19.2% 0.0% 0.0% 0.0% 90.00sec 2465991 300.83sec
Jukkayoto Jukkayoto shield_of_vengeance_proc 184689 3906434 12986 0.72 905644 1815328 3.8 3.6 19.2% 0.0% 0.0% 0.0% 89.42sec 3906434 300.83sec
Jukkayoto Jukkayoto templars_verdict 85256 68779541 228634 18.54 620511 1240779 93.0 93.0 19.2% 0.0% 0.0% 0.0% 3.23sec 68779541 300.83sec
Jukkayoto Jukkayoto wake_of_ashes 205273 3720870 12369 1.98 314485 626466 9.9 9.9 19.2% 0.0% 0.0% 0.0% 31.76sec 7545360 300.83sec
Jukkayoto Jukkayoto wake_of_ashes ticks -205273 3824491 12748 11.80 54335 108708 9.9 59.0 19.3% 0.0% 0.0% 0.0% 31.76sec 7545360 300.83sec
Waleràn Waleràn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Waleràn Waleràn deadly_grace 188091 3759159 12496 5.99 90597 184978 30.0 30.0 36.6% 0.0% 0.0% 0.0% 10.14sec 3759159 300.83sec
Waleràn Waleràn fel_meteor 214052 2859609 9506 7.48 55220 112582 37.5 37.5 36.7% 0.0% 0.0% 0.0% 7.97sec 2859609 300.83sec
Waleràn Waleràn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Waleràn Waleràn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Waleràn Waleràn mark_of_the_hidden_satyr 191259 2735478 9093 4.70 84253 171771 23.5 23.5 36.5% 0.0% 0.0% 0.0% 12.54sec 2735478 300.83sec
Waleràn Waleràn mental_fortitude 194018 0 0 32.41 0 0 162.5 162.5 36.7% 0.0% 0.0% 0.0% 1.83sec 12031879 300.83sec
Waleràn Waleràn mind_blast 8092 13495405 44861 9.18 212277 433131 45.0 46.0 36.6% 0.0% 0.0% 0.0% 6.57sec 13495405 300.83sec
Waleràn Waleràn mind_flay ticks -15407 19110268 63701 65.29 42387 86466 121.0 326.5 36.6% 0.0% 0.0% 0.0% 2.47sec 19110268 300.83sec
Waleràn Waleràn mind_sear_tick 234702 0 0 0.00 0 0 325.7 0.0 0.0% 0.0% 0.0% 0.0% 0.91sec 0 300.83sec
Waleràn Waleràn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Waleràn Waleràn power_infusion 10060 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 132.58sec 0 300.83sec
Waleràn Waleràn shadow_word_death 32379 2382167 7919 1.29 267427 545482 6.5 6.5 36.4% 0.0% 0.0% 0.0% 9.76sec 2382167 300.83sec
Waleràn Waleràn shadow_word_pain 589 324436 1078 1.22 38595 78722 6.1 6.1 36.5% 0.0% 0.0% 0.0% 46.44sec 17580090 300.83sec
Waleràn Waleràn shadow_word_pain ticks -589 17255655 57519 49.05 50949 103927 6.1 245.3 36.6% 0.0% 0.0% 0.0% 46.44sec 17580090 300.83sec
Waleràn Waleràn sphere_of_insanity 194182 0 0 0.00 0 0 244.3 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 0 300.83sec
Waleràn Waleràn shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.37sec 0 300.83sec
Waleràn Waleràn shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Waleràn Waleràn shadowy_apparitions 78203 2547576 8469 24.70 14895 30392 125.7 123.8 36.6% 0.0% 0.0% 0.0% 2.37sec 2547576 300.83sec
Waleràn Waleràn vampiric_touch ticks -34914 23851356 79505 32.50 106291 216828 4.7 162.5 36.6% 0.0% 0.0% 0.0% 71.90sec 23851356 300.83sec
Waleràn Waleràn void_bolt 205448 18999424 63157 13.47 203533 415453 67.8 67.6 36.7% 0.0% 0.0% 0.0% 4.27sec 18999424 300.83sec
Waleràn Waleràn void_eruption 228360 2145532 7132 3.49 88910 181373 8.8 17.5 36.6% 0.0% 0.0% 0.0% 35.40sec 2145532 300.83sec
Waleràn Waleràn void_torrent ticks -205065 7271261 24238 7.62 138383 282112 5.2 38.1 36.6% 0.0% 0.0% 0.0% 62.19sec 7271261 300.83sec
Waleràn Waleràn volatile_ichor 222187 3935332 13082 3.73 152339 310738 18.8 18.7 36.6% 0.0% 0.0% 0.0% 15.66sec 3935332 300.83sec
Waleràn Waleràn_shadowfiend melee 0 3142112 130921 71.36 80627 161217 28.5 28.5 36.6% 0.0% 0.0% 0.0% 7.04sec 3142112 24.00sec
Waleràn Waleràn_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 63.12sec 0 24.00sec
Waleràn Waleràn_void_tendril mind_flay_void_tendril ticks -193473 3454028 11513 13.21 38286 76572 7.5 66.0 36.6% 0.0% 0.0% 0.0% 38.68sec 3454028 73.37sec
Waleràn Waleràn_void_tendril mind_flay_void_tendril ticks -193473 893154 2977 3.41 38286 76572 1.9 17.0 36.8% 0.0% 0.0% 0.0% 88.76sec 893154 18.94sec
Waleràn Waleràn_void_tendril mind_flay_void_tendril ticks -193473 499903 1666 1.91 38286 76572 1.1 9.5 36.8% 0.0% 0.0% 0.0% 79.13sec 499903 10.61sec
Waleràn Waleràn_void_tendril mind_flay_void_tendril ticks -193473 471903 1573 1.79 38286 76572 1.0 8.9 37.8% 0.0% 0.0% 0.0% 121.69sec 471903 9.94sec
Waleràn Waleràn_void_tendril mind_flay_void_tendril ticks -193473 497717 1659 1.80 38286 76572 1.0 9.0 44.4% 0.0% 0.0% 0.0% 0.00sec 497717 10.00sec
Waleràn Waleràn_void_tendril mind_flay_void_tendril ticks -193473 497717 1659 1.80 38286 76572 1.0 9.0 44.4% 0.0% 0.0% 0.0% 0.00sec 497717 10.00sec
Ptitfille Ptitfille agonizing_poison 200803 0 0 0.00 0 0 254.8 0.0 0.0% 0.0% 0.0% 0.0% 1.30sec 0 300.83sec
Ptitfille Ptitfille augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ptitfille Ptitfille auto_attack_mh 0 5408110 17977 37.57 25383 50752 188.4 188.4 32.2% 19.0% 0.0% 0.0% 1.60sec 7950434 300.83sec
Ptitfille Ptitfille auto_attack_oh 1 2677876 8902 37.11 12704 25414 186.1 186.1 32.3% 19.0% 0.0% 0.0% 1.62sec 3936731 300.83sec
Ptitfille Ptitfille envenom 32645 19993911 66463 7.27 414317 830067 36.5 36.5 32.3% 0.0% 0.0% 0.0% 8.20sec 19993911 300.83sec
Ptitfille Ptitfille flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ptitfille Ptitfille food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ptitfille Ptitfille from_the_shadows 192434 3365146 11186 28.94 17538 35077 145.1 145.1 32.2% 0.0% 0.0% 0.0% 3.68sec 3365146 300.83sec
Ptitfille Ptitfille from_the_shadows_driver 192432 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 90.17sec 0 300.83sec
Ptitfille Ptitfille garrote ticks -703 10513473 35045 29.96 53061 106100 17.0 149.8 32.3% 0.0% 0.0% 0.0% 17.88sec 10513473 300.83sec
Ptitfille Ptitfille horrific_slam 222168 2909245 9671 13.03 33681 67359 65.3 65.3 32.2% 0.0% 0.0% 0.0% 3.09sec 2909245 300.83sec
Ptitfille Ptitfille insignia_of_ravenholdt 209043 5740785 19083 33.83 25593 51236 169.6 169.6 32.2% 0.0% 0.0% 0.0% 3.56sec 5740785 300.83sec
Ptitfille Ptitfille kingsbane ticks -192759 10093071 33644 9.61 158889 318015 7.0 48.0 32.2% 0.0% 0.0% 0.0% 45.43sec 10093071 300.83sec
Ptitfille Ptitfille kingsbane_mh 222062 2967498 9864 1.40 318722 636816 7.0 7.0 32.4% 0.0% 0.0% 0.0% 45.43sec 2967498 300.83sec
Ptitfille Ptitfille kingsbane_oh 192760 1486131 4940 1.40 159755 319203 7.0 7.0 32.2% 0.0% 0.0% 0.0% 45.43sec 1486131 300.83sec
Ptitfille Ptitfille mark_of_the_hidden_satyr 191259 2619036 8706 3.19 123973 248035 16.0 16.0 32.2% 0.0% 0.0% 0.0% 18.60sec 2619036 300.83sec
Ptitfille Ptitfille mutilate 1329 0 0 0.00 0 0 84.8 0.0 0.0% 0.0% 0.0% 0.0% 3.56sec 0 300.83sec
Ptitfille Ptitfille mutilate_mh 5374 12776376 42471 16.92 109024 218061 84.8 84.8 38.2% 0.0% 0.0% 0.0% 3.56sec 18782483 300.83sec
Ptitfille Ptitfille mutilate_oh 27576 6397570 21267 16.92 54546 109096 84.8 84.8 38.3% 0.0% 0.0% 0.0% 3.56sec 9405034 300.83sec
Ptitfille Ptitfille poison_bomb 192660 10063922 33454 7.62 199115 398238 38.2 38.2 32.3% 0.0% 0.0% 0.0% 6.02sec 10063922 300.83sec
Ptitfille Ptitfille potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Ptitfille Ptitfille potion_of_the_old_war 188028 6229331 20707 4.53 207297 414771 22.7 22.7 32.2% 0.0% 0.0% 0.0% 5.55sec 9157707 300.83sec
Ptitfille Ptitfille rupture ticks -1943 25685575 85619 29.61 119490 238887 12.7 148.1 45.2% 0.0% 0.0% 0.0% 23.76sec 25685575 300.83sec
Ptitfille Ptitfille shadow_wave 215047 3936258 13085 2.47 240770 481437 12.4 12.4 32.3% 0.0% 0.0% 0.0% 20.34sec 3936258 300.83sec
Ptitfille Ptitfille vanish 1856 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 135.58sec 0 300.83sec
Ptitfille Ptitfille vendetta 79140 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 90.17sec 0 300.83sec
Splouch Splouch agonizing_poison 200803 0 0 0.00 0 0 251.6 0.0 0.0% 0.0% 0.0% 0.0% 1.31sec 0 300.83sec
Splouch Splouch augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Splouch Splouch auto_attack_mh 0 5499153 18280 37.15 25216 50481 186.2 186.2 36.0% 19.0% 0.0% 0.0% 1.62sec 8084276 300.83sec
Splouch Splouch auto_attack_oh 1 2718908 9038 36.66 12627 25270 183.8 183.8 36.1% 19.0% 0.0% 0.0% 1.64sec 3997052 300.83sec
Splouch Splouch envenom 32645 17982617 59777 7.29 361025 722385 36.6 36.6 36.2% 0.0% 0.0% 0.0% 8.17sec 17982617 300.83sec
Splouch Splouch fan_of_knives 51723 3316281 11024 1.13 430331 866525 5.7 5.6 35.9% 0.0% 0.0% 0.0% 58.48sec 4875247 300.83sec
Splouch Splouch flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Splouch Splouch food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Splouch Splouch from_the_shadows 192434 3433247 11413 28.86 17440 34885 144.7 144.7 36.0% 0.0% 0.0% 0.0% 3.67sec 3433247 300.83sec
Splouch Splouch from_the_shadows_driver 192432 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.12sec 0 300.83sec
Splouch Splouch garrote ticks -703 10747048 35823 29.96 52704 105446 17.0 149.8 36.1% 0.0% 0.0% 0.0% 17.90sec 10747048 300.83sec
Splouch Splouch horrific_slam 222168 2910125 9674 12.81 33300 66627 64.2 64.2 36.1% 0.0% 0.0% 0.0% 3.15sec 2910125 300.83sec
Splouch Splouch insignia_of_ravenholdt 209043 5573820 18528 32.04 25498 51027 160.6 160.6 36.0% 0.0% 0.0% 0.0% 3.74sec 5573820 300.83sec
Splouch Splouch kingsbane ticks -192759 9677844 32259 9.59 148313 296577 7.0 48.0 36.1% 0.0% 0.0% 0.0% 45.37sec 9677844 300.83sec
Splouch Splouch kingsbane_mh 222062 2846436 9462 1.40 297517 594947 7.0 7.0 36.1% 0.0% 0.0% 0.0% 45.37sec 2846436 300.83sec
Splouch Splouch kingsbane_oh 192760 1423478 4732 1.40 149025 298209 7.0 7.0 35.9% 0.0% 0.0% 0.0% 45.37sec 1423478 300.83sec
Splouch Splouch mutilate 1329 0 0 0.00 0 0 80.3 0.0 0.0% 0.0% 0.0% 0.0% 3.74sec 0 300.83sec
Splouch Splouch mutilate_mh 5374 12417493 41278 16.02 108820 217746 80.3 80.3 42.0% 0.0% 0.0% 0.0% 3.74sec 18254891 300.83sec
Splouch Splouch mutilate_oh 27576 6214999 20660 16.02 54443 108917 80.3 80.3 42.1% 0.0% 0.0% 0.0% 3.74sec 9136637 300.83sec
Splouch Splouch poison_bomb 192660 9545487 31731 7.53 185532 371052 37.8 37.8 36.2% 0.0% 0.0% 0.0% 6.01sec 9545487 300.83sec
Splouch Splouch potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Splouch Splouch potion_of_the_old_war 188028 6275965 20862 4.50 204629 410316 22.6 22.6 35.7% 0.0% 0.0% 0.0% 5.62sec 9226263 300.83sec
Splouch Splouch rupture ticks -1943 26902529 89675 29.56 122115 243966 12.7 147.8 49.2% 0.0% 0.0% 0.0% 23.77sec 26902529 300.83sec
Splouch Splouch vanish 1856 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 133.55sec 0 300.83sec
Splouch Splouch vendetta 79140 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.12sec 0 300.83sec
Dèmonos Dèmonos augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos chaos_bolt 116858 19034560 63274 6.62 0 573867 32.4 33.2 100.0% 0.0% 0.0% 0.0% 9.01sec 19034560 300.83sec
Dèmonos Dèmonos conflagrate 17962 8230758 27360 6.68 140514 322681 33.5 33.5 57.7% 0.0% 0.0% 0.0% 9.04sec 8230758 300.83sec
Dèmonos Dèmonos deadly_grace 188091 2692054 8949 4.92 92909 185818 24.7 24.7 17.4% 0.0% 0.0% 0.0% 12.23sec 2692054 300.83sec
Dèmonos Dèmonos dimensional_rift 196586 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.76sec 0 300.83sec
Dèmonos Dèmonos flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos immolate 348 2655692 8828 3.45 97443 194897 17.3 17.3 57.8% 0.0% 0.0% 0.0% 17.82sec 12936647 300.83sec
Dèmonos Dèmonos immolate ticks -348 10280955 34270 25.73 50719 101510 17.3 128.6 57.5% 0.0% 0.0% 0.0% 17.82sec 12936647 300.83sec
Dèmonos Dèmonos incinerate 29722 23264649 77335 25.05 157536 315078 126.4 125.6 17.6% 0.0% 0.0% 0.0% 2.33sec 23264649 300.83sec
Dèmonos Dèmonos mark_of_the_hidden_satyr 191259 1866156 6203 3.68 86057 172114 18.4 18.4 17.6% 0.0% 0.0% 0.0% 16.15sec 1866156 300.83sec
Dèmonos Dèmonos plague_swarm ticks -221812 4216265 14054 12.95 55410 110787 14.7 64.8 17.5% 0.0% 0.0% 0.0% 20.37sec 4216265 300.83sec
Dèmonos Dèmonos potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.85sec 0 300.83sec
Dèmonos Dèmonos summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Dèmonos Dèmonos tormenting_cyclone 221857 1457972 4847 15.05 16441 32881 11.0 75.4 17.5% 0.0% 0.0% 0.0% 26.23sec 1457972 300.83sec
Dèmonos Dèmonos_imp firebolt 3110 8347996 27750 19.87 71275 142539 100.4 99.6 17.5% 0.0% 0.0% 0.0% 3.00sec 8347996 300.83sec
Dèmonos Dèmonos_service_imp firebolt 3110 7519213 78163 27.90 143028 286055 45.0 44.7 17.5% 0.0% 0.0% 0.0% 6.05sec 7519213 96.20sec
Dèmonos Dèmonos_infernal immolation ticks -19483 594213 1981 4.00 25252 50503 1.0 20.0 17.7% 0.0% 0.0% 0.0% 0.00sec 594213 25.00sec
Dèmonos Dèmonos_infernal melee 0 354903 14196 48.00 15100 30201 20.0 20.0 17.5% 0.0% 0.0% 0.0% 1.24sec 521741 25.00sec
Dèmonos Dèmonos_doomguard doom_bolt 85692 1565843 62631 24.00 133329 266659 10.0 10.0 17.4% 0.0% 0.0% 0.0% 2.42sec 1565843 25.00sec
Dèmonos Dèmonos_lord_of_flames_infernal immolation ticks -19483 594468 1982 4.00 25252 50503 1.0 20.0 17.7% 0.0% 0.0% 0.0% 0.00sec 594468 25.00sec
Dèmonos Dèmonos_lord_of_flames_infernal melee 0 355261 14210 48.00 15100 30201 20.0 20.0 17.6% 0.0% 0.0% 0.0% 1.24sec 522267 25.00sec
Dèmonos Dèmonos_lord_of_flames_infernal immolation ticks -19483 594071 1980 4.00 25252 50503 1.0 20.0 17.6% 0.0% 0.0% 0.0% 0.00sec 594071 25.00sec
Dèmonos Dèmonos_lord_of_flames_infernal melee 0 354654 14186 48.00 15100 30201 20.0 20.0 17.4% 0.0% 0.0% 0.0% 1.24sec 521375 25.00sec
Dèmonos Dèmonos_lord_of_flames_infernal immolation ticks -19483 593629 1979 4.00 25252 50503 1.0 20.0 17.5% 0.0% 0.0% 0.0% 0.00sec 593629 25.00sec
Dèmonos Dèmonos_lord_of_flames_infernal melee 0 355140 14205 48.00 15100 30201 20.0 20.0 17.6% 0.0% 0.0% 0.0% 1.24sec 522089 25.00sec
Dèmonos Dèmonos_shadowy_tear shadow_bolt ticks -196657 4298891 14330 9.88 74424 148783 5.2 49.4 17.6% 0.0% 0.0% 0.0% 53.91sec 4298891 59.73sec
Dèmonos Dèmonos_chaos_tear chaos_bolt 215279 2305750 96894 12.73 0 456705 5.1 5.0 100.0% 0.0% 0.0% 0.0% 51.98sec 2305750 23.80sec
Dèmonos Dèmonos_chaos_portal chaos_barrage ticks -187394 3745665 12486 30.56 20938 41893 5.2 152.8 17.6% 0.0% 0.0% 0.0% 53.59sec 3745665 26.12sec
Zuan Zuan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Zuan Zuan auto_attack_mh 0 8999097 29914 20.40 68846 141176 102.3 102.3 26.5% 0.0% 0.0% 0.0% 2.96sec 13229525 300.83sec
Zuan Zuan avatar 107574 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 90.29sec 0 300.83sec
Zuan Zuan battle_cry 1719 0 0 0.00 0 0 10.6 0.0 0.0% 0.0% 0.0% 0.0% 29.86sec 0 300.83sec
Zuan Zuan bladestorm 227847 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 113.25sec 0 300.83sec
Zuan Zuan bladestorm_mh 50622 1073169 3567 1.48 131012 262588 0.0 7.4 10.6% 0.0% 0.0% 0.0% 0.00sec 1577660 300.83sec
Zuan Zuan charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Zuan Zuan colossus_smash 167105 19176872 63747 9.96 319354 631769 49.9 49.9 20.7% 0.0% 0.0% 0.0% 6.12sec 28191819 300.83sec
Zuan Zuan corrupted_blood_of_zakajz ticks -209569 13647404 45491 10.93 249785 0 0.0 54.6 0.0% 0.0% 0.0% 0.0% 0.00sec 13647404 300.83sec
Zuan Zuan execute 163201 22164042 73677 5.70 491752 1069442 28.6 28.6 49.0% 0.0% 0.0% 0.0% 2.15sec 32583241 300.83sec
Zuan Zuan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Zuan Zuan focused_rage 207982 0 0 0.00 0 0 151.1 0.0 0.0% 0.0% 0.0% 0.0% 1.94sec 0 300.83sec
Zuan Zuan heroic_leap 6544 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.08sec 0 300.83sec
Zuan Zuan horrific_slam 222168 3908988 12994 14.11 43558 88465 70.8 70.8 26.0% 0.0% 0.0% 0.0% 3.02sec 3908988 300.83sec
Zuan Zuan mark_of_the_hidden_satyr 191259 3769394 12530 3.48 170355 347845 17.4 17.4 25.7% 0.0% 0.0% 0.0% 17.19sec 3769394 300.83sec
Zuan Zuan mortal_strike 12294 52881745 175787 13.55 485642 1123014 67.9 67.9 46.0% 0.0% 0.0% 0.0% 4.40sec 77741174 300.83sec
Zuan Zuan pepper_breath ticks -225622 2224382 7415 13.80 32255 0 13.9 69.0 0.0% 0.0% 0.0% 0.0% 21.30sec 2224382 300.83sec
Zuan Zuan potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Zuan Zuan potion_of_the_old_war 188028 9910658 32945 4.87 304235 648385 24.4 24.4 29.6% 0.0% 0.0% 0.0% 5.50sec 14569605 300.83sec
Zuan Zuan shadow_wave 215047 4906168 16309 2.68 284360 581771 13.4 13.4 27.2% 0.0% 0.0% 0.0% 19.13sec 4906168 300.83sec
Zuan Zuan slam 1464 19183382 63769 16.27 182005 361984 81.6 81.6 29.5% 0.0% 0.0% 0.0% 2.89sec 28201388 300.83sec
Zuan Zuan warbreaker 209577 1606444 5340 0.80 318098 673829 4.0 4.0 22.7% 0.0% 0.0% 0.0% 73.19sec 1606444 300.83sec
Islandar Islandar augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Islandar Islandar auto_attack_mh 0 16161579 53724 39.08 56385 128589 195.9 195.9 39.3% 4.0% 0.0% 0.0% 1.54sec 23759052 300.83sec
Islandar Islandar auto_attack_oh 1 8126066 27012 39.08 28421 64528 195.9 195.9 39.3% 4.0% 0.0% 0.0% 1.54sec 11946087 300.83sec
Islandar Islandar avatar 107574 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 88.83sec 0 300.83sec
Islandar Islandar battle_cry 1719 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.03sec 0 300.83sec
Islandar Islandar bloodthirst 23881 17111647 56882 15.31 141200 308965 76.8 76.8 48.7% 0.0% 0.0% 0.0% 3.91sec 25155742 300.83sec
Islandar Islandar brutal_haymaker 214169 952006 3165 0.95 133942 312715 4.8 4.8 36.7% 0.0% 0.0% 0.0% 54.16sec 1399539 300.83sec
Islandar Islandar brutal_haymaker_vulnerability 228784 2260433 7514 7.70 58541 0 38.7 38.6 0.0% 0.0% 0.0% 0.0% 5.59sec 2260433 300.83sec
Islandar Islandar charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Islandar Islandar execute 5308 17982650 59777 5.70 366505 888428 28.6 28.6 50.4% 0.0% 0.0% 0.0% 2.16sec 26436199 300.83sec
Islandar Islandar execute_offhand 163558 8995959 29904 5.70 183245 444129 0.0 28.6 50.5% 0.0% 0.0% 0.0% 0.00sec 13224911 300.83sec
Islandar Islandar flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Islandar Islandar food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Islandar Islandar furious_slash 100130 5751561 19119 8.92 91714 203949 44.7 44.7 32.8% 0.0% 0.0% 0.0% 5.80sec 8455339 300.83sec
Islandar Islandar heroic_leap 6544 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 27.35sec 0 300.83sec
Islandar Islandar mark_of_the_hidden_satyr 191259 3632265 12074 3.93 123455 289419 19.7 19.7 36.8% 0.0% 0.0% 0.0% 15.25sec 3632265 300.83sec
Islandar Islandar odyns_fury 205545 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 44.19sec 0 300.83sec
Islandar Islandar odyns_fury_mh 205546 3225597 10722 1.17 0 547852 0.0 5.9 100.0% 0.0% 0.0% 0.0% 0.00sec 6493686 300.83sec
Islandar Islandar odyns_fury_mh ticks -205546 3268089 10894 4.71 55226 143858 0.0 23.6 94.3% 0.0% 0.0% 0.0% 0.00sec 6493686 300.83sec
Islandar Islandar odyns_fury_oh 205547 1612799 5361 1.17 0 273926 0.0 5.9 100.0% 0.0% 0.0% 0.0% 0.00sec 1612799 300.83sec
Islandar Islandar potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
Islandar Islandar potion_of_the_old_war 188028 8255097 27441 5.27 187591 454193 26.4 26.4 46.9% 0.0% 0.0% 0.0% 11.46sec 12135775 300.83sec
Islandar Islandar raging_blow 85288 0 0 0.00 0 0 78.0 0.0 0.0% 0.0% 0.0% 0.0% 3.83sec 0 300.83sec
Islandar Islandar raging_blow_oh 85384 14065408 46756 15.56 120487 283658 0.0 78.0 36.7% 0.0% 0.0% 0.0% 0.00sec 20677482 300.83sec
Islandar Islandar raging_blow_mh 96103 28150826 93578 15.56 240898 567379 0.0 78.0 36.7% 0.0% 0.0% 0.0% 0.00sec 41384380 300.83sec
Islandar Islandar rampage 184367 0 0 0.00 0 0 29.0 0.0 0.0% 0.0% 0.0% 0.0% 8.39sec 0 300.83sec
Islandar Islandar rampage1 218617 1392214 4628 5.78 32343 71546 0.0 29.0 40.1% 0.0% 0.0% 0.0% 0.00sec 2046686 300.83sec
Islandar Islandar rampage2 184707 2355508 7830 5.78 54525 121288 0.0 29.0 40.1% 0.0% 0.0% 0.0% 0.00sec 3462820 300.83sec
Islandar Islandar rampage3 184709 3124256 10386 5.78 72195 160949 0.0 29.0 40.2% 0.0% 0.0% 0.0% 0.00sec 4592953 300.83sec
Islandar Islandar rampage4 201364 4757973 15816 5.78 108914 243750 0.0 29.0 41.0% 0.0% 0.0% 0.0% 0.00sec 6994672 300.83sec
Islandar Islandar rampage5 201363 5546213 18436 5.78 126907 284006 0.0 29.0 41.1% 0.0% 0.0% 0.0% 0.00sec 8153459 300.83sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.25% 10.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.30% 10.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.16% 11.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.32% 11.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.12% 11.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.53% 10.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.95% 10.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.54% 11.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.59% 7.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.59%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.24% 5.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Agonizing Poison 1.0 250.6 45.9sec 1.2sec 99.58% 100.00% 246.6(246.6) 0.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_agonizing_poison
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • agonizing_poison_1:0.44%
  • agonizing_poison_2:0.40%
  • agonizing_poison_3:0.37%
  • agonizing_poison_4:0.33%
  • agonizing_poison_5:98.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:200803
  • name:Agonizing Poison
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${$200803s1}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Agonizing Poison 1.0 253.8 0.5sec 1.2sec 99.64% 100.00% 249.8(249.8) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_agonizing_poison
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • agonizing_poison_1:0.40%
  • agonizing_poison_2:0.38%
  • agonizing_poison_3:0.37%
  • agonizing_poison_4:0.33%
  • agonizing_poison_5:98.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:200803
  • name:Agonizing Poison
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${$200803s1}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Blood of the Assassinated 4.5 0.0 56.1sec 56.1sec 14.75% 14.00% 0.0(0.0) 4.4

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:14.75%

Trigger Attempt Success

  • trigger_pct:35.00%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood of the Assassinated 4.5 0.0 55.9sec 55.9sec 14.76% 13.95% 0.0(0.0) 4.4

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:14.76%

Trigger Attempt Success

  • trigger_pct:34.96%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Brutal Haymaker 4.8 0.0 54.6sec 54.2sec 13.41% 13.41% 0.0(0.0) 0.1

Buff details

  • buff initial source:Islandar
  • cooldown name:buff_brutal_haymaker
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:480225.92

Stack Uptimes

  • brutal_haymaker_1:13.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214169
  • name:Brutal Haymaker
  • tooltip:Damage taken from the caster increased by $s2%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal $214169s1 Physical damage and increase all damage the target takes from you by $214169s2% for {$214169d=15 seconds}, up to $214169s3 extra damage dealt.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 8.1 45.8 36.5sec 5.6sec 88.48% 89.10% 45.8(45.8) 7.2

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:88.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 22.4 10.8 13.6sec 9.1sec 61.29% 61.29% 10.8(10.8) 21.7

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:61.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 26.4 43.1 11.6sec 4.3sec 87.02% 95.87% 43.1(43.1) 25.5

Buff details

  • buff initial source:Jukkayoto
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:87.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 25.3 40.1 12.1sec 4.6sec 82.86% 94.38% 40.1(40.1) 24.5

Buff details

  • buff initial source:Illaz
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:82.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane 7.0 82.0 45.3sec 3.2sec 45.23% 85.60% 0.0(0.0) 6.6

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:2.44%
  • kingsbane_2:2.73%
  • kingsbane_3:2.48%
  • kingsbane_4:2.43%
  • kingsbane_5:2.51%
  • kingsbane_6:2.71%
  • kingsbane_7:2.91%
  • kingsbane_8:3.17%
  • kingsbane_9:3.33%
  • kingsbane_10:3.36%
  • kingsbane_11:3.25%
  • kingsbane_12:2.93%
  • kingsbane_13:2.58%
  • kingsbane_14:2.13%
  • kingsbane_15:1.74%
  • kingsbane_16:1.35%
  • kingsbane_17:1.04%
  • kingsbane_18:0.75%
  • kingsbane_19:0.53%
  • kingsbane_20:0.36%
  • kingsbane_21:0.23%
  • kingsbane_22:0.14%
  • kingsbane_23:0.08%
  • kingsbane_24:0.04%
  • kingsbane_25:0.02%
  • kingsbane_26:0.01%
  • kingsbane_27:0.00%
  • kingsbane_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Kingsbane 7.0 82.3 45.4sec 3.2sec 45.30% 85.66% 0.0(0.0) 6.6

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:2.45%
  • kingsbane_2:2.77%
  • kingsbane_3:2.51%
  • kingsbane_4:2.44%
  • kingsbane_5:2.50%
  • kingsbane_6:2.68%
  • kingsbane_7:2.90%
  • kingsbane_8:3.12%
  • kingsbane_9:3.29%
  • kingsbane_10:3.36%
  • kingsbane_11:3.20%
  • kingsbane_12:2.95%
  • kingsbane_13:2.61%
  • kingsbane_14:2.19%
  • kingsbane_15:1.76%
  • kingsbane_16:1.39%
  • kingsbane_17:1.04%
  • kingsbane_18:0.77%
  • kingsbane_19:0.54%
  • kingsbane_20:0.34%
  • kingsbane_21:0.22%
  • kingsbane_22:0.12%
  • kingsbane_23:0.07%
  • kingsbane_24:0.04%
  • kingsbane_25:0.02%
  • kingsbane_26:0.01%
  • kingsbane_27:0.00%
  • kingsbane_28:0.01%
  • kingsbane_29:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Maddening Whispers 2.3 20.5 161.6sec 10.1sec 5.71% 5.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.28%
  • maddening_whispers_2:0.52%
  • maddening_whispers_3:0.68%
  • maddening_whispers_4:0.67%
  • maddening_whispers_5:0.64%
  • maddening_whispers_6:0.68%
  • maddening_whispers_7:0.68%
  • maddening_whispers_8:0.73%
  • maddening_whispers_9:0.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. This may only occur once every ${$proccooldown}.1 sec. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Perseverance of the Ebon Martyr 12.7 87.8 24.0sec 2.9sec 49.69% 49.69% 87.8(87.8) 12.2

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_perseverance_of_the_ebon_martyr
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • perseverance_of_the_ebon_martyr_1:49.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216059
  • name:Perseverance of the Ebon Martyr
  • tooltip:
  • description:Howling Blast deals $s1% increased damage to enemies recently damage by your Remorseless Winter.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Poisoned Dreams 4.8 0.0 56.7sec 56.7sec 30.52% 30.52% 4.4(4.4) 4.4

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_poisoned_dreams
  • max_stacks:10
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • poisoned_dreams_1:3.15%
  • poisoned_dreams_2:3.13%
  • poisoned_dreams_3:3.11%
  • poisoned_dreams_4:3.08%
  • poisoned_dreams_5:3.06%
  • poisoned_dreams_6:3.04%
  • poisoned_dreams_7:3.02%
  • poisoned_dreams_8:3.00%
  • poisoned_dreams_9:2.98%
  • poisoned_dreams_10:2.96%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:222706
  • name:Poisoned Dreams
  • tooltip:The caster's damaging spells deal up to $222705s1 additional damage as Shadow. Spreading to nearby targets.
  • description:{$@spelldesc222705=Your damaging spells have a chance to afflict the target with Nightmare Corruption for {$222706d=20 seconds}, causing your spells to deal up to $s1 additional damage as Shadow. Every $222706t2 sec Nightmare Corruption attempts to spread to a nearby enemy. If no uninfected enemies are nearby, the intensity of the Corruption increases.}
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Razorice 1.0 355.9 0.2sec 0.8sec 99.94% 100.00% 351.9(351.9) 0.0

Buff details

  • buff initial source:Bonerot
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:0.29%
  • razorice_2:0.19%
  • razorice_3:0.20%
  • razorice_4:0.28%
  • razorice_5:98.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 353.5 0.0sec 0.8sec 99.94% 100.00% 349.5(349.5) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:0.29%
  • razorice_2:0.19%
  • razorice_3:0.21%
  • razorice_4:0.31%
  • razorice_5:98.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 311.1 0.4sec 1.0sec 99.94% 100.00% 307.1(307.1) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:0.30%
  • razorice_2:0.20%
  • razorice_3:0.21%
  • razorice_4:0.29%
  • razorice_5:98.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Toxins 37.7 11.6 8.0sec 6.1sec 75.99% 77.11% 11.6(11.6) 37.0

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:75.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Surge of Toxins 37.9 11.3 7.9sec 6.1sec 76.26% 77.69% 11.3(11.3) 37.2

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:76.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Taint of the Sea 2.7 0.0 143.2sec 143.2sec 13.06% 13.06% 0.0(0.0) 2.6

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_taint_of_the_sea
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:30.00

Stack Uptimes

  • taint_of_the_sea_1:13.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215670
  • name:Taint of the Sea
  • tooltip:Taking a portion of the damage dealt to other enemies.
  • description:Inflict Taint of the Sea on an enemy for {$d=15 seconds}, causing them to take $s1% of the damage you deal to all other enemies, up to $215672s1 total damage.|CFF808080$?!(a137013|a137015|a137016|a137018|a137032|a137033|a137040|a137042)[ Valid for ranged damage specializations.][]|R
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Touch of the Magi 8.6 0.0 32.8sec 32.8sec 17.04% 17.04% 0.0(0.0) 8.5

Buff details

  • buff initial source:Eldiablø
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • touch_of_the_magi_1:17.04%

Trigger Attempt Success

  • trigger_pct:10.21%

Spelldata details

  • id:210824
  • name:Touch of the Magi
  • tooltip:Accumulating Damage...
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta 3.7 0.0 90.1sec 90.1sec 24.12% 22.42% 0.0(0.0) 3.5

Buff details

  • buff initial source:Splouch
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:24.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vendetta 3.8 0.0 90.1sec 90.2sec 24.19% 22.11% 0.0(0.0) 3.5

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:24.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 6554534.67
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 17650
death count pct 176.38
avg death time 300.70
min death time 229.38
max death time 375.41
dmg taken 1972110960.25

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 300.83
Minimum 229.37
Maximum 375.41
Spread ( max - min ) 146.04
Range [ ( max - min ) / 2 * 100% ] 24.27%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 6567104.02
Minimum 6218225.80
Maximum 6934098.09
Spread ( max - min ) 715872.28
Range [ ( max - min ) / 2 * 100% ] 5.45%
Standard Deviation 106261.8491
5th Percentile 6387420.97
95th Percentile 6736902.24
( 95th Percentile - 5th Percentile ) 349481.27
Mean Distribution
Standard Deviation 1062.6716
95.00% Confidence Intervall ( 6565021.23 - 6569186.82 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1006
0.1 Scale Factor Error with Delta=300 96391427
0.05 Scale Factor Error with Delta=300 385565706
0.01 Scale Factor Error with Delta=300 9639142635
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1081
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2360862903 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.